SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_0348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_0348
Domain Number 1 Region: 37-133
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_0348
Sequence length 151
Comment (Mycobacterium JLS)
Sequence
MTLTSTSTGSHSAFHYGNPSFDCDRVRMRARCRQLATVVTVTGDIDADNLSCVADYARRF
VLAEKPFILDLSGVSTFAAEGLSLFYEIDARCAEADVEWSVIGSQPVLQVLRASGTLDDM
PVTASVPEALHHFSEGILARRRLLPLLTKTA
Download sequence
Identical sequences A0A1A0UHM6 A0A1X0GHN6 A1U9S8
164756.Mmcs_0359 164757.Mjls_0348 189918.Mkms_0369 gi|119866424|ref|YP_936376.1| WP_011557786.1.20321 WP_011557786.1.3374 WP_011557786.1.37251 WP_011557786.1.44017 WP_011557786.1.47369 WP_011557786.1.73225 gi|108797339|ref|YP_637536.1| gi|126432961|ref|YP_001068652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]