SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_1311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_1311
Domain Number 1 Region: 29-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_1311
Sequence length 141
Comment (Mycobacterium JLS)
Sequence
MSSSIIQPVPSTEPTICHTARFEASAPLPSTTVVTVTGELDAANARDFADFALLHAGGAL
IVDLAGVEFFGTAGFSALHTLNVRCAGADINWILVPSAAVSRLLRICDPDATLPWSESVE
TALTALQGEPRPLLQLVAEPR
Download sequence
Identical sequences A0A1A0UQH2 A0A1X0HAV0
164757.Mjls_1311 gi|126433913|ref|YP_001069604.1| WP_011854975.1.3374 WP_011854975.1.37251 WP_011854975.1.44017 WP_011854975.1.73225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]