SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_2267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_2267
Domain Number 1 Region: 17-64
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000586
Family Terminase gpNU1 subunit domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_2267
Sequence length 73
Comment (Mycobacterium JLS)
Sequence
MSVPRTDRAEAQPRRRYATQAEAAEYLGVTTRTIRQMIADGRLIGYRLNPRFIRVDLNEI
DAAMTPTGGGAAR
Download sequence
Identical sequences gi|126434853|ref|YP_001070544.1| 164757.Mjls_2267 WP_011855483.1.44017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]