SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_3889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164757.Mjls_3889
Domain Number - Region: 19-39
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0471
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_3889
Sequence length 89
Comment (Mycobacterium JLS)
Sequence
MTTPTATPSVDPFHDFWLPDYCPRCNPAGHHADRCVRLATQTEPDAVTWRGGRGLVCDYV
CDGCGHQWRRADLWTAECAGFNPKQRRAA
Download sequence
Identical sequences A0A1X0GKF3 A0A1X0JSE8
gi|126436465|ref|YP_001072156.1| WP_011856344.1.3374 WP_011856344.1.44017 WP_011856344.1.57941 164757.Mjls_3889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]