SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_5536 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_5536
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000235
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 
Weak hits

Sequence:  164757.Mjls_5536
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily R3H domain 0.0824
Family R3H domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_5536
Sequence length 139
Comment (Mycobacterium JLS)
Sequence
MTITPLHGHSRPHVHATHSDRLALSTRSWGRPPHKRICVAVRGEVDAANAKDFAVAVCEA
IDFRHPGRYAVEVDLRSLGFLAVDGIAALHALNAEFVRHDVTWTVIPGPAVSRLLALCDP
EGVIPRADTTADPQEAEPA
Download sequence
Identical sequences A0A1A0TVN9 A0A1X0GEH2
gi|126438099|ref|YP_001073790.1| 164757.Mjls_5536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]