SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164757.Mjls_5566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164757.Mjls_5566
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164757.Mjls_5566
Sequence length 114
Comment (Mycobacterium JLS)
Sequence
MVRVKGDVDSLSVDALNSHLAKARGNAVCHPSRLVVIDLSEVTYFGSAALNAVLSCHEEG
AAEGTSVAIVADQPYVMQPIQITGLHRVLETHPTIEQALQRDGQSPDGEGRTPR
Download sequence
Identical sequences gi|126438129|ref|YP_001073820.1| 164757.Mjls_5566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]