SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167539.Pro0804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167539.Pro0804
Domain Number 1 Region: 435-518
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 
Weak hits

Sequence:  167539.Pro0804
Domain Number - Region: 389-437
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0785
Family Respiratory nitrate reductase 1 gamma chain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167539.Pro0804
Sequence length 525
Comment (Prochlorococcus marinus CCMP1375)
Sequence
MLIKTKSTVLEEWFSNPRKDILSGLVVAFAMIPEAIAFSGIAGVDPQVGLFGAFCLSITI
ALIGGRMGMITSATGSTALLMTGVVATGNAQGNGLGLSYLIAAGLLTGIFQIIWGYLRLA
YQMRFVPTGVLSGFVNALALLIFQAQLPQMGLNFHYGEEIAKGQAEQVLPVGIQIPIVWL
LIALGLLIIYGLPKITKVIPSQLVAILIITIISIQLPIDIPTVKDLGQLPIGLPSFELPF
GSIADGKVPFNLETFGIVLPTALAISLVGLMETFLTQDIIDDITDTNSNKNTEARGQGIA
NIVSSLFGGMAGCALVGQSVMNAENGGRSRLSTFSSGISLLIMILLCKQWLEQIPMAALV
AVMITIAISTADTNGLKNISKIPRSDTAVMIMTFSVTMLTTPHNLALGVIAGVALAGILF
SRKVAKVIRVTSYKNDNNEIIYEVSGQLFFVSKIYFLQGFDTHDHPKTIKIDMSEAHIWD
QSGVTALDQIIRKLSLGGSNVEVIGLNKESLDLFDRLGGQEPSHG
Download sequence
Identical sequences Q7VCD6
167539.Pro0804 NP_875196.1.92868 WP_011124956.1.25276 WP_011124956.1.37041 WP_011124956.1.47494 WP_011124956.1.71786 WP_011124956.1.74834 gi|33240254|ref|NP_875196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]