SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167542.P9515_07101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167542.P9515_07101
Domain Number 1 Region: 435-518
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167542.P9515_07101
Sequence length 524
Comment (Prochlorococcus marinus MIT 9515)
Sequence
MSNFTKYLSKNWLDDPKSNILSGLVVAFAMIPEAIAFSGIAGVDPKVGLYGAFCLSITIA
ILGGRRGMITSATGSTALLMTGVVSIGEAQAPGTNLGLSYLIAAGLLTGVFQILWGYLRL
AYQMRFVPTGVLSGFVNALALLIFQAQFLQLGIGINEGKLLENELTKYPTISQVPTVWIL
VIFGLIIIYGFPKITKVIPSQLVAIVLLTFTSLFFQLDIPTVSDLGTLPNGFPSFSLPFG
ELENGKVPFNLSTLGVILPTSLAISLVGLMETFLTQDILDDATDTSSNKNKEARGQGIAN
LISSLFGGMAGCALVGQSVMNNENGGKSRLSTLTSGLSLLLMIILLKPWIGAIPMAALVA
IMITIAISTADLNGLKNIRKIPKSDTAVMLMTFAVTMLTKPHNLALGVIAGVGLAAILFS
RKVAKVITVSKVKDKDKNQITYKVEGQLFFVSKIYFLQGFDIHEHPKNILIDMSLAHIWD
QSGVVALDQIIRKFKNSGSKVDIIGLNKESLNLFERLGGLETSH
Download sequence
Identical sequences A2BVV8
gi|123965945|ref|YP_001011026.1| WP_011820024.1.83733 167542.P9515_07101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]