SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167555.NATL1_05381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  167555.NATL1_05381
Domain Number - Region: 10-61
Classification Level Classification E-value
Superfamily POZ domain 0.033
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167555.NATL1_05381
Sequence length 64
Comment (Prochlorococcus marinus NATL1A)
Sequence
MDSLIKKLSKKAIDLSGKSKKELERTCWMIVHEYKHGAMPTEYDIREIDEELYLQVLSMA
KEMI
Download sequence
Identical sequences A0A0A2BZ12 A0A2D7LSI8 A2C0U0
167555.NATL1_05381 gi|124025249|ref|YP_001014365.1| WP_011823278.1.44141 WP_011823278.1.83531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]