SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167555.NATL1_14611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167555.NATL1_14611
Domain Number 1 Region: 417-498
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167555.NATL1_14611
Sequence length 514
Comment (Prochlorococcus marinus NATL1A)
Sequence
MKLKNLLVKERIISPSRDVIAGLVVAFAMIPEAIAFSGIAGVDPRVGLFGAFLLSVTLAI
FGGRMAMITSVTGSTALLMTGIVQQGENISPGLGLQYLLAAGLLTGVLQIAWGYLRLAHQ
MRFVPQPVMDGFVNGLAILIFLAQLPHLGIDIAHSEKVVTAVQLPAVWGLTILTLLIIYL
LPKFTKLLPSALVAIFICTAISIVFKLNVPTVSNLGILPNGLPSFGIPKVPFNFETLGLI
LPTALAISLVGLMETFLTQDILDDMTDKSTNKNVEARGQGMGNIVSSLFGGMAGCALVGQ
SVMNVGYGGRTRLSTLSSGVCLIAMILAAKDWVNQIPMATLVGVMIMIAINTANWGSIKD
IRRIPRSDSSVMILTVFVTVITHNLALGLLSGVGLAAILFSRKVAKVIKVESSLNGKDHR
IYKVSGQLFFVSSIYFRQGFELHEHPKKITIDMAEAHIWDQSGVTVLDQVIRRIKIGGSE
VEVINLNDESLNLFSRIGQASEAGGRGGEFKSAH
Download sequence
Identical sequences A2C3F9
167555.NATL1_14611 WP_011824045.1.44141 gi|124026168|ref|YP_001015284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]