SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_1173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_1173
Domain Number 1 Region: 106-385
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-76
Family D-glucarate dehydratase-like 0.000000334
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.95e-31
Family Enolase N-terminal domain-like 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_1173
Sequence length 391
Comment (Colwellia psychrerythraea 34H)
Sequence
MKITHVEVFDIHCPKRIGWNPVFIRIHTDEGISGVGEAGLAYDWGHSAAAAMIKEISEAV
LIGFNPFNTELLWSRMLRESFWGLGGGPVLYSAMSAIDTALWDIKGKALGVPVYQLLGGK
VNDKLRTYASQLQFDWDTEISKLIEPEQYAEAALKAIAQGYDAVKVDPIVYNGDGSSSFD
RTKLFTKPQMRLFGNRLRAIRDAVGEDVDIIFESHSLMGAASAIQMGRIVEEVGCMMYEE
PVNYLNPAVHKKVSDNVNVPIAGGERLYHRWDVRPYFEDQSIDVLQPDVGLCGGFTESKK
VCDYADVYDIRIQAHVCGGPVATAASLHLETAIPNFLIHEHHTYAIKDWNRELCLQDPQP
VDGFFQVTEVPGIGIELNDAIVKKSPNVTIK
Download sequence
Identical sequences Q486U9
gi|71281434|ref|YP_267916.1| WP_011042010.1.15195 167879.CPS_1173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]