SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_2684 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_2684
Domain Number 1 Region: 11-207
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.76e-28
Family Clp protease, ClpP subunit 0.055
Further Details:      
 
Domain Number 2 Region: 379-439
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000562
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_2684
Sequence length 454
Comment (Colwellia psychrerythraea 34H)
Sequence
MLKKILFLITFILLIQQYGNAQLSPPLNQSKWTVPVLSIDGAIGPAVSEYLVTEITKANN
DSSIPLVIIKLDTPGGLSSSLREINQQILNSTIPIACLVYPQGARAASAGTYMLYACHYA
AMAPATTLGAATPVSIAPPASNQGEDKKNKSPSAMEKKVLNDAIAYIRSLAQLRNRNEQW
AELAVSEAATLTAEEALAENVINFIVPTAEALFATIIKQKHSEHHFAEVTTDNTQLKAVP
PNWRNDFIATITNPNIAYILMLIGIYGLVLEFYSPGVGVAGITGVISLLIALYAFQLLPL
NYSGFALLLVGISLLIIESIMPSFGVFGIGGTIAFVLGSIFLIDTEQPQYQISLPLIAAF
AFVSILFFVLSLGLMWRKRKNKIVSGQEELIGAIAFAEASFTHQGFVTINGERWAAEFTQ
PVKQNQAVKIKAIDGLTLITIPCREEENNHGRCV
Download sequence
Identical sequences Q480X1
167879.CPS_2684 WP_011043492.1.15195 gi|71280002|ref|YP_269398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]