SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_3033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_3033
Domain Number 1 Region: 94-301
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-26
Family Phosphate binding protein-like 0.0013
Further Details:      
 
Domain Number 2 Region: 5-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.24e-19
Family LysR-like transcriptional regulators 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_3033
Sequence length 312
Comment (Colwellia psychrerythraea 34H)
Sequence
MARYLRNVDLNLLSIFTALMHEKNISHAAENLGMTQPAVSQALKRLRSLYNDPLFERKSG
KMMPTLKADEIYPIINKILADVSSTLPDTGDFLPETANLNFHINILGVGNNDFLTKLSQR
LAHVAPNISLTVSTEMLVDAEKSLRDKEYDLHLDYLTIDEIGCHHQELFNDQLFIIARKG
HPNLNNKTNLLLSEYLAEKHAVLAPRKGNVYPLSLALQDFSYNREIKYTSTSIENILEIV
SATDLICIMPGTVLQSMHNVNDYIWFNPPFKTKQMIAYMNWHWSMEHVKSHRWLRTIIID
ICKNMQPLPSIE
Download sequence
Identical sequences Q47ZN8
WP_011043821.1.15195 402704 gi|71280242|ref|YP_269732.1| 167879.CPS_3033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]