SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_4106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_4106
Domain Number 1 Region: 144-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.97e-127
Family Enolase 0.00000000182
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.59e-54
Family Enolase N-terminal domain-like 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_4106
Sequence length 432
Comment (Colwellia psychrerythraea 34H)
Sequence
MSKISKILAREIMDSRGNPTVEADVYLESGAFGRAAAPSGASTGSREALELRDGDKARYL
GKGVLKAVAAINVNIQAALIGQSALDQANIDQIMIDLDGTENKEQFGANAILAVSLANAK
AAANEKKVQLFEHIADLNGTPGVYSLPLPMMNIINGGEHADNNVDIQEFMVQPVGAKSFR
EALRMGAEIFHALKKVLSSKGMSTSVGDEGGFAPNLESNADALAVIKVAVEAAGYELGKD
VTLAMDCAASEFYDADKGIYDLTGEGKQFTANEFSDFLGELCKEYPIVSIEDGLDESDWD
GFKYQTDLLGDKVQIVGDDLFVTNTKILARGIENGIGNSILIKFNQIGTLTETLAAIKMA
KDAGFTAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVSKYNQLLRIEEFLGDK
AIFNGLSEVKGQ
Download sequence
Identical sequences Q47WR1
gi|71280073|ref|YP_270761.1| WP_011044842.1.15195 167879.CPS_4106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]