SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_4926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_4926
Domain Number 1 Region: 64-188
Classification Level Classification E-value
Superfamily CheY-like 7.68e-28
Family CheY-related 0.0052
Further Details:      
 
Domain Number 2 Region: 8-55
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000215
Family DNA-binding N-terminal domain of transcription activators 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_4926
Sequence length 192
Comment (Colwellia psychrerythraea 34H)
Sequence
MDISKKSLLTPAEAAKLLHVAPTTIRHWAQIGRLPFISTPGGHRRFDRNDILSLMSTPKI
NVKNDFSILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLM
MVGMDGFSICHRIKSTPATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKT
IKQLVEQKKATS
Download sequence
Identical sequences Q47UF8
167879.CPS_4926 gi|71277797|ref|YP_271565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]