SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 167879.CPS_4947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  167879.CPS_4947
Domain Number 1 Region: 644-818
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 9-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.87e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 3 Region: 513-652
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.05e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 
Weak hits

Sequence:  167879.CPS_4947
Domain Number - Region: 359-414
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.053
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 167879.CPS_4947
Sequence length 866
Comment (Colwellia psychrerythraea 34H)
Sequence
MNTDKQLLTKTNIVVVGNGMVGHHFVEEMAKNPNYQITVLSAESRLAYDRVHLSEYFGGK
TADDLAMTTPEHYEALGVTFKTNAKVILIDKIVQYVTTESGETYHYDKLILATGSYPFVP
PIPGKDQDHCLVYRTIDDLEDIAASAKESKVGVVIGGGLLGLEAANAIKQLGLQTHVVEF
APQLMGVQIDGGGGRLLRQKIEDLGVQVHTSKATSVIEKGNTSRYKLCFSDETELETDLI
LFSAGIRPYDNLAREFDLTLGERGGIVVNNQCQTSDENIYAIGECALWNNFIFGLVAPGY
AMAKVVAKHIAGFTNEGNGENGEIAEFTGADMSTKLKLMGVEVGSIGDAHGKTEGALTYT
YENQPEGVYKKIVVSSDKKSLLGAVLIGDTSEYDTLLQYMLNAIELPESPEGLILPMAAD
KPTLGVDALPDTATICSCHNVTKGDIIASIDAGAMTVGDVKSCTKAGSGCGGCAALVKSV
ADNEFEKRGVEVKKDICEHFAYSRQEIYDIVSVGKIKTFDELLEKHGRGLGCEICKPVAG
SVLASVWNDYILKKPHLSLQDTNDTYLGNMQKDGTYSVVPRIAGGEITPDKLIVLGEVAK
KYNLYTKITGGARVDLFGARVEQLPPIWKELVDAGFETGHAYGKSLRTVKSCVGSTWCRY
GVQDSMSMAIDLEHRYKGLRAPHKIKFGVSGCTRECAEAQGKDIGIIATDNGWNLYVAGN
GGMKPRHGDLFATDLDDETLVKYVDRILMFYVQTGDRLQRTSTWIDNLEGGLAYLQDVII
NDSLGLNDALETQMKAIVGTYQCEWKTTIEDPEALKRFQPFVNSDKSDSNIQFVTEREQI
RPARGQEKIDVKFIDATEKEAVAEEA
Download sequence
Identical sequences Q47UD7
gi|71277901|ref|YP_271586.1| 167879.CPS_4947 WP_011045666.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]