SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 169963.lmo0889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169963.lmo0889
Domain Number 1 Region: 154-248
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169963.lmo0889
Sequence length 278
Comment (Listeria monocytogenes)
Sequence
MYKDFANFIRTNKADLLNDWMNEMEKQSDQLINDIAKEAMYEETSKEFVDLIVSNVTENG
SKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDLFLKREEKPEDDAYYRF
ETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEKISVMPLIGTIDTERAKL
IIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAVRLVGCQAMLVGIRPEIAQ
TIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG
Download sequence
Identical sequences A0A0H3GB91 A0A1D2IX68 A0A2G8PRP8 A0A2G8Q833 A0A2G8QGX0 A0A2G8QXX4 A0A2G8R5U3 Q8Y8K9
gi|470209765|ref|YP_007606339.1| gi|404412973|ref|YP_006698560.1| gi|284994361|ref|YP_003416129.1| gi|405754966|ref|YP_006678430.1| gi|386046551|ref|YP_005964883.1| gi|525733343|ref|YP_008289093.1| gi|16802930|ref|NP_464415.1| 169963.lmo0889 gi|550897062|ref|YP_008666558.1| NP_464415.1.42710 WP_003721456.1.100045 WP_003721456.1.100078 WP_003721456.1.100112 WP_003721456.1.100229 WP_003721456.1.100261 WP_003721456.1.100510 WP_003721456.1.100530 WP_003721456.1.101057 WP_003721456.1.101093 WP_003721456.1.10112 WP_003721456.1.101184 WP_003721456.1.101252 WP_003721456.1.101354 WP_003721456.1.101368 WP_003721456.1.101688 WP_003721456.1.101772 WP_003721456.1.10186 WP_003721456.1.101945 WP_003721456.1.10198 WP_003721456.1.10418 WP_003721456.1.10420 WP_003721456.1.10444 WP_003721456.1.10484 WP_003721456.1.11177 WP_003721456.1.1123 WP_003721456.1.11266 WP_003721456.1.11313 WP_003721456.1.11326 WP_003721456.1.11419 WP_003721456.1.1146 WP_003721456.1.11686 WP_003721456.1.11712 WP_003721456.1.11738 WP_003721456.1.11779 WP_003721456.1.11788 WP_003721456.1.11851 WP_003721456.1.11940 WP_003721456.1.11973 WP_003721456.1.11976 WP_003721456.1.12037 WP_003721456.1.12143 WP_003721456.1.12377 WP_003721456.1.12824 WP_003721456.1.12988 WP_003721456.1.13052 WP_003721456.1.13160 WP_003721456.1.13304 WP_003721456.1.13428 WP_003721456.1.13695 WP_003721456.1.137 WP_003721456.1.13833 WP_003721456.1.13921 WP_003721456.1.14072 WP_003721456.1.14103 WP_003721456.1.14339 WP_003721456.1.15518 WP_003721456.1.1556 WP_003721456.1.15659 WP_003721456.1.1575 WP_003721456.1.1576 WP_003721456.1.15816 WP_003721456.1.16207 WP_003721456.1.16499 WP_003721456.1.1657 WP_003721456.1.16634 WP_003721456.1.16726 WP_003721456.1.17228 WP_003721456.1.17352 WP_003721456.1.17375 WP_003721456.1.17604 WP_003721456.1.1764 WP_003721456.1.17774 WP_003721456.1.178 WP_003721456.1.1794 WP_003721456.1.17947 WP_003721456.1.1803 WP_003721456.1.18046 WP_003721456.1.18222 WP_003721456.1.18463 WP_003721456.1.18576 WP_003721456.1.18648 WP_003721456.1.18689 WP_003721456.1.18721 WP_003721456.1.18979 WP_003721456.1.19080 WP_003721456.1.19371 WP_003721456.1.19409 WP_003721456.1.1947 WP_003721456.1.19542 WP_003721456.1.19548 WP_003721456.1.19626 WP_003721456.1.19901 WP_003721456.1.20402 WP_003721456.1.20416 WP_003721456.1.21046 WP_003721456.1.21099 WP_003721456.1.21133 WP_003721456.1.21338 WP_003721456.1.21529 WP_003721456.1.21542 WP_003721456.1.21705 WP_003721456.1.21884 WP_003721456.1.21926 WP_003721456.1.22099 WP_003721456.1.22154 WP_003721456.1.22202 WP_003721456.1.22434 WP_003721456.1.22656 WP_003721456.1.22776 WP_003721456.1.22962 WP_003721456.1.23193 WP_003721456.1.23254 WP_003721456.1.2340 WP_003721456.1.23582 WP_003721456.1.23624 WP_003721456.1.23650 WP_003721456.1.2368 WP_003721456.1.2422 WP_003721456.1.24349 WP_003721456.1.24370 WP_003721456.1.24411 WP_003721456.1.24546 WP_003721456.1.24651 WP_003721456.1.24818 WP_003721456.1.24836 WP_003721456.1.24945 WP_003721456.1.25020 WP_003721456.1.25057 WP_003721456.1.25401 WP_003721456.1.25830 WP_003721456.1.26052 WP_003721456.1.26060 WP_003721456.1.26103 WP_003721456.1.26138 WP_003721456.1.26139 WP_003721456.1.26145 WP_003721456.1.26146 WP_003721456.1.26320 WP_003721456.1.26350 WP_003721456.1.26406 WP_003721456.1.26523 WP_003721456.1.26632 WP_003721456.1.26891 WP_003721456.1.27143 WP_003721456.1.27200 WP_003721456.1.27281 WP_003721456.1.27669 WP_003721456.1.27728 WP_003721456.1.27826 WP_003721456.1.27839 WP_003721456.1.28042 WP_003721456.1.28062 WP_003721456.1.28123 WP_003721456.1.28325 WP_003721456.1.28722 WP_003721456.1.28747 WP_003721456.1.28792 WP_003721456.1.28803 WP_003721456.1.2920 WP_003721456.1.29331 WP_003721456.1.29550 WP_003721456.1.29565 WP_003721456.1.29705 WP_003721456.1.29723 WP_003721456.1.29738 WP_003721456.1.29762 WP_003721456.1.29872 WP_003721456.1.30124 WP_003721456.1.30193 WP_003721456.1.30227 WP_003721456.1.30267 WP_003721456.1.305 WP_003721456.1.30827 WP_003721456.1.30837 WP_003721456.1.30882 WP_003721456.1.30902 WP_003721456.1.31108 WP_003721456.1.31116 WP_003721456.1.31444 WP_003721456.1.31485 WP_003721456.1.31584 WP_003721456.1.31830 WP_003721456.1.3206 WP_003721456.1.32209 WP_003721456.1.32210 WP_003721456.1.32278 WP_003721456.1.32472 WP_003721456.1.32622 WP_003721456.1.32681 WP_003721456.1.32817 WP_003721456.1.3324 WP_003721456.1.33240 WP_003721456.1.33336 WP_003721456.1.33688 WP_003721456.1.337 WP_003721456.1.33875 WP_003721456.1.33995 WP_003721456.1.34326 WP_003721456.1.34732 WP_003721456.1.34849 WP_003721456.1.34851 WP_003721456.1.350 WP_003721456.1.35135 WP_003721456.1.35350 WP_003721456.1.35402 WP_003721456.1.35450 WP_003721456.1.35979 WP_003721456.1.36181 WP_003721456.1.36203 WP_003721456.1.36241 WP_003721456.1.364 WP_003721456.1.36877 WP_003721456.1.36936 WP_003721456.1.37278 WP_003721456.1.37518 WP_003721456.1.37561 WP_003721456.1.3782 WP_003721456.1.37882 WP_003721456.1.37986 WP_003721456.1.38025 WP_003721456.1.38076 WP_003721456.1.38150 WP_003721456.1.38224 WP_003721456.1.38281 WP_003721456.1.384 WP_003721456.1.38471 WP_003721456.1.3853 WP_003721456.1.38792 WP_003721456.1.38800 WP_003721456.1.38833 WP_003721456.1.39115 WP_003721456.1.3919 WP_003721456.1.39218 WP_003721456.1.39262 WP_003721456.1.3959 WP_003721456.1.39630 WP_003721456.1.39871 WP_003721456.1.39887 WP_003721456.1.40124 WP_003721456.1.40245 WP_003721456.1.40263 WP_003721456.1.404 WP_003721456.1.405 WP_003721456.1.40720 WP_003721456.1.40820 WP_003721456.1.40841 WP_003721456.1.40953 WP_003721456.1.40976 WP_003721456.1.41023 WP_003721456.1.41281 WP_003721456.1.41903 WP_003721456.1.41909 WP_003721456.1.41955 WP_003721456.1.41970 WP_003721456.1.42010 WP_003721456.1.42127 WP_003721456.1.4218 WP_003721456.1.42339 WP_003721456.1.42564 WP_003721456.1.42615 WP_003721456.1.42672 WP_003721456.1.42926 WP_003721456.1.42958 WP_003721456.1.43060 WP_003721456.1.43267 WP_003721456.1.4371 WP_003721456.1.44023 WP_003721456.1.44106 WP_003721456.1.44596 WP_003721456.1.44645 WP_003721456.1.44703 WP_003721456.1.4479 WP_003721456.1.44897 WP_003721456.1.44924 WP_003721456.1.4503 WP_003721456.1.45295 WP_003721456.1.45309 WP_003721456.1.45524 WP_003721456.1.4557 WP_003721456.1.4562 WP_003721456.1.45708 WP_003721456.1.45758 WP_003721456.1.45759 WP_003721456.1.4578 WP_003721456.1.45811 WP_003721456.1.45877 WP_003721456.1.45994 WP_003721456.1.4604 WP_003721456.1.46045 WP_003721456.1.4615 WP_003721456.1.46154 WP_003721456.1.46314 WP_003721456.1.46425 WP_003721456.1.46711 WP_003721456.1.46863 WP_003721456.1.46867 WP_003721456.1.46883 WP_003721456.1.47055 WP_003721456.1.47412 WP_003721456.1.47593 WP_003721456.1.4766 WP_003721456.1.47738 WP_003721456.1.47759 WP_003721456.1.47952 WP_003721456.1.47953 WP_003721456.1.48180 WP_003721456.1.48358 WP_003721456.1.48435 WP_003721456.1.48441 WP_003721456.1.48471 WP_003721456.1.48572 WP_003721456.1.48624 WP_003721456.1.48661 WP_003721456.1.48999 WP_003721456.1.49146 WP_003721456.1.49202 WP_003721456.1.49205 WP_003721456.1.49415 WP_003721456.1.49467 WP_003721456.1.49604 WP_003721456.1.49668 WP_003721456.1.4974 WP_003721456.1.49952 WP_003721456.1.49962 WP_003721456.1.50073 WP_003721456.1.5020 WP_003721456.1.50236 WP_003721456.1.50334 WP_003721456.1.50482 WP_003721456.1.50862 WP_003721456.1.50888 WP_003721456.1.50898 WP_003721456.1.50926 WP_003721456.1.50971 WP_003721456.1.5129 WP_003721456.1.51318 WP_003721456.1.51435 WP_003721456.1.51510 WP_003721456.1.51720 WP_003721456.1.51732 WP_003721456.1.5175 WP_003721456.1.52177 WP_003721456.1.52371 WP_003721456.1.52395 WP_003721456.1.52447 WP_003721456.1.52617 WP_003721456.1.52684 WP_003721456.1.52725 WP_003721456.1.52867 WP_003721456.1.52989 WP_003721456.1.53102 WP_003721456.1.53161 WP_003721456.1.5317 WP_003721456.1.53193 WP_003721456.1.53266 WP_003721456.1.53378 WP_003721456.1.53536 WP_003721456.1.53807 WP_003721456.1.53877 WP_003721456.1.53920 WP_003721456.1.54046 WP_003721456.1.54160 WP_003721456.1.5417 WP_003721456.1.54181 WP_003721456.1.54564 WP_003721456.1.54639 WP_003721456.1.54646 WP_003721456.1.54890 WP_003721456.1.55027 WP_003721456.1.55231 WP_003721456.1.55238 WP_003721456.1.55487 WP_003721456.1.55510 WP_003721456.1.55683 WP_003721456.1.55740 WP_003721456.1.55797 WP_003721456.1.55824 WP_003721456.1.55847 WP_003721456.1.55850 WP_003721456.1.55890 WP_003721456.1.5601 WP_003721456.1.56269 WP_003721456.1.56526 WP_003721456.1.56566 WP_003721456.1.56759 WP_003721456.1.56923 WP_003721456.1.57171 WP_003721456.1.57374 WP_003721456.1.57404 WP_003721456.1.57504 WP_003721456.1.57505 WP_003721456.1.57547 WP_003721456.1.57578 WP_003721456.1.57625 WP_003721456.1.57766 WP_003721456.1.57948 WP_003721456.1.57963 WP_003721456.1.58030 WP_003721456.1.58069 WP_003721456.1.58088 WP_003721456.1.58177 WP_003721456.1.58532 WP_003721456.1.58544 WP_003721456.1.58661 WP_003721456.1.58828 WP_003721456.1.59045 WP_003721456.1.59343 WP_003721456.1.59353 WP_003721456.1.59477 WP_003721456.1.59493 WP_003721456.1.59571 WP_003721456.1.59720 WP_003721456.1.59799 WP_003721456.1.59826 WP_003721456.1.59937 WP_003721456.1.59949 WP_003721456.1.60166 WP_003721456.1.60191 WP_003721456.1.60219 WP_003721456.1.60258 WP_003721456.1.60297 WP_003721456.1.60346 WP_003721456.1.60369 WP_003721456.1.60665 WP_003721456.1.60768 WP_003721456.1.60956 WP_003721456.1.61072 WP_003721456.1.611 WP_003721456.1.61244 WP_003721456.1.61371 WP_003721456.1.61525 WP_003721456.1.61894 WP_003721456.1.62177 WP_003721456.1.62629 WP_003721456.1.62655 WP_003721456.1.62663 WP_003721456.1.62690 WP_003721456.1.62852 WP_003721456.1.62972 WP_003721456.1.63359 WP_003721456.1.63605 WP_003721456.1.63676 WP_003721456.1.63842 WP_003721456.1.63951 WP_003721456.1.6397 WP_003721456.1.64041 WP_003721456.1.64227 WP_003721456.1.64259 WP_003721456.1.64413 WP_003721456.1.6460 WP_003721456.1.648 WP_003721456.1.64869 WP_003721456.1.65143 WP_003721456.1.65213 WP_003721456.1.65309 WP_003721456.1.65376 WP_003721456.1.6579 WP_003721456.1.65827 WP_003721456.1.65913 WP_003721456.1.66005 WP_003721456.1.66039 WP_003721456.1.66311 WP_003721456.1.66338 WP_003721456.1.66510 WP_003721456.1.66512 WP_003721456.1.6672 WP_003721456.1.66884 WP_003721456.1.66903 WP_003721456.1.67165 WP_003721456.1.6731 WP_003721456.1.67352 WP_003721456.1.67610 WP_003721456.1.6763 WP_003721456.1.67668 WP_003721456.1.67694 WP_003721456.1.67709 WP_003721456.1.67795 WP_003721456.1.67884 WP_003721456.1.68112 WP_003721456.1.68123 WP_003721456.1.68197 WP_003721456.1.68208 WP_003721456.1.68301 WP_003721456.1.68321 WP_003721456.1.68414 WP_003721456.1.68525 WP_003721456.1.68528 WP_003721456.1.69190 WP_003721456.1.69263 WP_003721456.1.69265 WP_003721456.1.69360 WP_003721456.1.69471 WP_003721456.1.69570 WP_003721456.1.69579 WP_003721456.1.69631 WP_003721456.1.69727 WP_003721456.1.6982 WP_003721456.1.69989 WP_003721456.1.70309 WP_003721456.1.7051 WP_003721456.1.70588 WP_003721456.1.70690 WP_003721456.1.70992 WP_003721456.1.71468 WP_003721456.1.71585 WP_003721456.1.71753 WP_003721456.1.71921 WP_003721456.1.72051 WP_003721456.1.72057 WP_003721456.1.72116 WP_003721456.1.7218 WP_003721456.1.72467 WP_003721456.1.72566 WP_003721456.1.72636 WP_003721456.1.72841 WP_003721456.1.72918 WP_003721456.1.73656 WP_003721456.1.73769 WP_003721456.1.74217 WP_003721456.1.74290 WP_003721456.1.74303 WP_003721456.1.74351 WP_003721456.1.74450 WP_003721456.1.7454 WP_003721456.1.74572 WP_003721456.1.74754 WP_003721456.1.74837 WP_003721456.1.74927 WP_003721456.1.74956 WP_003721456.1.7498 WP_003721456.1.75069 WP_003721456.1.75240 WP_003721456.1.7528 WP_003721456.1.75541 WP_003721456.1.75604 WP_003721456.1.75624 WP_003721456.1.75670 WP_003721456.1.76124 WP_003721456.1.76247 WP_003721456.1.76367 WP_003721456.1.76545 WP_003721456.1.76769 WP_003721456.1.76926 WP_003721456.1.77116 WP_003721456.1.77149 WP_003721456.1.7718 WP_003721456.1.77192 WP_003721456.1.77222 WP_003721456.1.77246 WP_003721456.1.77345 WP_003721456.1.7736 WP_003721456.1.77376 WP_003721456.1.77420 WP_003721456.1.77681 WP_003721456.1.77697 WP_003721456.1.77928 WP_003721456.1.78121 WP_003721456.1.78167 WP_003721456.1.78203 WP_003721456.1.78315 WP_003721456.1.78336 WP_003721456.1.78525 WP_003721456.1.78681 WP_003721456.1.79128 WP_003721456.1.79184 WP_003721456.1.79212 WP_003721456.1.79295 WP_003721456.1.7932 WP_003721456.1.79351 WP_003721456.1.79434 WP_003721456.1.79458 WP_003721456.1.79630 WP_003721456.1.79803 WP_003721456.1.79964 WP_003721456.1.80105 WP_003721456.1.80790 WP_003721456.1.81261 WP_003721456.1.81476 WP_003721456.1.81495 WP_003721456.1.81503 WP_003721456.1.81713 WP_003721456.1.81833 WP_003721456.1.82274 WP_003721456.1.82440 WP_003721456.1.82667 WP_003721456.1.82719 WP_003721456.1.82821 WP_003721456.1.82893 WP_003721456.1.82951 WP_003721456.1.83030 WP_003721456.1.83121 WP_003721456.1.83137 WP_003721456.1.83260 WP_003721456.1.83323 WP_003721456.1.83350 WP_003721456.1.83478 WP_003721456.1.83542 WP_003721456.1.83546 WP_003721456.1.83809 WP_003721456.1.83907 WP_003721456.1.83932 WP_003721456.1.8418 WP_003721456.1.84180 WP_003721456.1.84265 WP_003721456.1.84320 WP_003721456.1.84367 WP_003721456.1.84579 WP_003721456.1.84586 WP_003721456.1.84588 WP_003721456.1.8460 WP_003721456.1.84781 WP_003721456.1.84833 WP_003721456.1.84980 WP_003721456.1.85036 WP_003721456.1.85203 WP_003721456.1.85576 WP_003721456.1.85690 WP_003721456.1.8593 WP_003721456.1.86091 WP_003721456.1.86098 WP_003721456.1.86253 WP_003721456.1.86279 WP_003721456.1.86308 WP_003721456.1.86484 WP_003721456.1.86597 WP_003721456.1.866 WP_003721456.1.86683 WP_003721456.1.86958 WP_003721456.1.87085 WP_003721456.1.8710 WP_003721456.1.87108 WP_003721456.1.87536 WP_003721456.1.87701 WP_003721456.1.87794 WP_003721456.1.8782 WP_003721456.1.87920 WP_003721456.1.88015 WP_003721456.1.88063 WP_003721456.1.88112 WP_003721456.1.88128 WP_003721456.1.88397 WP_003721456.1.88485 WP_003721456.1.88584 WP_003721456.1.88589 WP_003721456.1.8884 WP_003721456.1.88877 WP_003721456.1.88890 WP_003721456.1.88974 WP_003721456.1.89085 WP_003721456.1.89160 WP_003721456.1.8932 WP_003721456.1.89386 WP_003721456.1.89443 WP_003721456.1.89450 WP_003721456.1.89478 WP_003721456.1.89505 WP_003721456.1.89756 WP_003721456.1.89809 WP_003721456.1.8988 WP_003721456.1.89916 WP_003721456.1.90086 WP_003721456.1.9019 WP_003721456.1.90201 WP_003721456.1.90567 WP_003721456.1.90772 WP_003721456.1.90821 WP_003721456.1.90829 WP_003721456.1.9109 WP_003721456.1.91168 WP_003721456.1.91443 WP_003721456.1.91514 WP_003721456.1.91556 WP_003721456.1.91560 WP_003721456.1.91765 WP_003721456.1.91922 WP_003721456.1.92049 WP_003721456.1.92132 WP_003721456.1.92142 WP_003721456.1.92148 WP_003721456.1.92274 WP_003721456.1.92370 WP_003721456.1.92409 WP_003721456.1.92494 WP_003721456.1.92548 WP_003721456.1.92591 WP_003721456.1.92595 WP_003721456.1.93217 WP_003721456.1.93556 WP_003721456.1.93777 WP_003721456.1.93859 WP_003721456.1.93895 WP_003721456.1.93920 WP_003721456.1.93997 WP_003721456.1.94032 WP_003721456.1.94058 WP_003721456.1.94059 WP_003721456.1.94191 WP_003721456.1.94336 WP_003721456.1.94499 WP_003721456.1.94758 WP_003721456.1.95186 WP_003721456.1.95715 WP_003721456.1.95945 WP_003721456.1.96033 WP_003721456.1.96140 WP_003721456.1.96296 WP_003721456.1.96407 WP_003721456.1.9643 WP_003721456.1.96496 WP_003721456.1.96586 WP_003721456.1.9672 WP_003721456.1.96874 WP_003721456.1.96940 WP_003721456.1.97165 WP_003721456.1.97199 WP_003721456.1.97203 WP_003721456.1.97315 WP_003721456.1.9732 WP_003721456.1.97378 WP_003721456.1.97390 WP_003721456.1.97633 WP_003721456.1.97752 WP_003721456.1.97820 WP_003721456.1.98038 WP_003721456.1.98042 WP_003721456.1.98193 WP_003721456.1.98331 WP_003721456.1.98351 WP_003721456.1.98490 WP_003721456.1.98866 WP_003721456.1.9894 WP_003721456.1.98974 WP_003721456.1.99026 WP_003721456.1.9916 WP_003721456.1.99357 WP_003721456.1.99409 WP_003721456.1.99480 WP_003721456.1.99512 WP_003721456.1.99518 WP_003721456.1.99520 WP_003721456.1.99527 WP_003721456.1.99663 WP_003721456.1.99785 WP_003721456.1.99786 WP_003721456.1.99906 WP_003721456.1.99914 WP_003721456.1.99974 gi|470206633|ref|YP_007603208.1| gi|284801219|ref|YP_003413084.1| gi|404283331|ref|YP_006684228.1| gi|386043214|ref|YP_005962019.1| gi|404410129|ref|YP_006695717.1| gi|386053157|ref|YP_005970715.1| gi|405757886|ref|YP_006687162.1| gi|386049817|ref|YP_005967808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]