SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 169963.lmo0890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  169963.lmo0890
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 169963.lmo0890
Sequence length 118
Comment (Listeria monocytogenes)
Sequence
MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVVIDITSIDFIDSFIAK
ILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMDLESGLEKLKQELGE
Download sequence
Identical sequences A0A0D8X5U2 A0A0E0UUZ1 A0A0E1R5E3 A0A0F5Z3B1 A0A0H3GIX1 A0A241SN59 A0A2G8PRQ5 A0A2G8Q868 A0A2G8QH41 A0A2G8QYW9 A0A2G8R5S3 A0AH08 E3YNJ5 E3ZNM0 Q7AP18 Q92DC5
gi|404286300|ref|YP_006692886.1| gi|16802931|ref|NP_464416.1| gi|386731645|ref|YP_006205141.1| gi|550897063|ref|YP_008666559.1| APC63294 gi|386053158|ref|YP_005970716.1| gi|404280441|ref|YP_006681339.1| gi|386007617|ref|YP_005925895.1| gi|525721443|ref|YP_008285838.1| gi|525733344|ref|YP_008289094.1| gi|116872292|ref|YP_849073.1| gi|405752109|ref|YP_006675574.1| gi|405754967|ref|YP_006678431.1| gi|406703665|ref|YP_006754019.1| gi|386049818|ref|YP_005967809.1| gi|470209766|ref|YP_007606340.1| gi|470206634|ref|YP_007603209.1| gi|289434158|ref|YP_003464030.1| gi|386043215|ref|YP_005962020.1| gi|226223509|ref|YP_002757616.1| gi|217965013|ref|YP_002350691.1| NP_464416.1.42710 WP_003721457.1.100045 WP_003721457.1.100060 WP_003721457.1.100078 WP_003721457.1.100112 WP_003721457.1.100142 WP_003721457.1.100147 WP_003721457.1.100160 WP_003721457.1.100221 WP_003721457.1.100229 WP_003721457.1.100261 WP_003721457.1.10039 WP_003721457.1.100458 WP_003721457.1.100510 WP_003721457.1.100522 WP_003721457.1.100530 WP_003721457.1.100651 WP_003721457.1.10073 WP_003721457.1.100835 WP_003721457.1.101057 WP_003721457.1.101093 WP_003721457.1.10112 WP_003721457.1.101144 WP_003721457.1.101184 WP_003721457.1.101252 WP_003721457.1.101318 WP_003721457.1.101354 WP_003721457.1.101368 WP_003721457.1.101527 WP_003721457.1.101529 WP_003721457.1.101688 WP_003721457.1.101752 WP_003721457.1.10176 WP_003721457.1.101772 WP_003721457.1.101811 WP_003721457.1.10182 WP_003721457.1.10186 WP_003721457.1.101945 WP_003721457.1.10198 WP_003721457.1.10210 WP_003721457.1.102145 WP_003721457.1.102150 WP_003721457.1.10418 WP_003721457.1.10444 WP_003721457.1.10460 WP_003721457.1.10484 WP_003721457.1.11086 WP_003721457.1.11177 WP_003721457.1.1123 WP_003721457.1.11266 WP_003721457.1.11326 WP_003721457.1.11419 WP_003721457.1.1146 WP_003721457.1.1160 WP_003721457.1.11633 WP_003721457.1.11686 WP_003721457.1.11689 WP_003721457.1.11712 WP_003721457.1.11738 WP_003721457.1.11779 WP_003721457.1.11788 WP_003721457.1.11851 WP_003721457.1.11907 WP_003721457.1.11940 WP_003721457.1.11973 WP_003721457.1.11976 WP_003721457.1.12020 WP_003721457.1.12028 WP_003721457.1.12037 WP_003721457.1.12142 WP_003721457.1.12143 WP_003721457.1.12148 WP_003721457.1.12278 WP_003721457.1.12287 WP_003721457.1.12377 WP_003721457.1.12417 WP_003721457.1.12544 WP_003721457.1.12634 WP_003721457.1.12824 WP_003721457.1.12988 WP_003721457.1.12993 WP_003721457.1.13004 WP_003721457.1.13052 WP_003721457.1.13134 WP_003721457.1.13160 WP_003721457.1.13180 WP_003721457.1.13304 WP_003721457.1.13329 WP_003721457.1.1336 WP_003721457.1.13360 WP_003721457.1.13428 WP_003721457.1.13684 WP_003721457.1.13695 WP_003721457.1.137 WP_003721457.1.13779 WP_003721457.1.13833 WP_003721457.1.13847 WP_003721457.1.13855 WP_003721457.1.13921 WP_003721457.1.14029 WP_003721457.1.14072 WP_003721457.1.14103 WP_003721457.1.14339 WP_003721457.1.14636 WP_003721457.1.14641 WP_003721457.1.14832 WP_003721457.1.14895 WP_003721457.1.15085 WP_003721457.1.15122 WP_003721457.1.15340 WP_003721457.1.15342 WP_003721457.1.15495 WP_003721457.1.155 WP_003721457.1.15518 WP_003721457.1.1556 WP_003721457.1.15564 WP_003721457.1.15618 WP_003721457.1.15619 WP_003721457.1.15659 WP_003721457.1.1575 WP_003721457.1.1576 WP_003721457.1.15816 WP_003721457.1.15847 WP_003721457.1.16207 WP_003721457.1.16403 WP_003721457.1.16499 WP_003721457.1.16516 WP_003721457.1.1657 WP_003721457.1.16631 WP_003721457.1.16634 WP_003721457.1.1667 WP_003721457.1.16726 WP_003721457.1.16746 WP_003721457.1.1678 WP_003721457.1.1688 WP_003721457.1.17106 WP_003721457.1.17131 WP_003721457.1.17228 WP_003721457.1.17352 WP_003721457.1.17375 WP_003721457.1.17398 WP_003721457.1.17399 WP_003721457.1.1764 WP_003721457.1.17644 WP_003721457.1.17695 WP_003721457.1.17774 WP_003721457.1.178 WP_003721457.1.1794 WP_003721457.1.17947 WP_003721457.1.18026 WP_003721457.1.1803 WP_003721457.1.18046 WP_003721457.1.18222 WP_003721457.1.18289 WP_003721457.1.18463 WP_003721457.1.18576 WP_003721457.1.18648 WP_003721457.1.18677 WP_003721457.1.18689 WP_003721457.1.18721 WP_003721457.1.18800 WP_003721457.1.18833 WP_003721457.1.18979 WP_003721457.1.19080 WP_003721457.1.19112 WP_003721457.1.19167 WP_003721457.1.19189 WP_003721457.1.19195 WP_003721457.1.19246 WP_003721457.1.1929 WP_003721457.1.19371 WP_003721457.1.19372 WP_003721457.1.19409 WP_003721457.1.19443 WP_003721457.1.19452 WP_003721457.1.1947 WP_003721457.1.19472 WP_003721457.1.19542 WP_003721457.1.19548 WP_003721457.1.19549 WP_003721457.1.19584 WP_003721457.1.19607 WP_003721457.1.19615 WP_003721457.1.19626 WP_003721457.1.19685 WP_003721457.1.197 WP_003721457.1.19901 WP_003721457.1.20263 WP_003721457.1.20378 WP_003721457.1.20402 WP_003721457.1.20416 WP_003721457.1.20548 WP_003721457.1.20672 WP_003721457.1.21046 WP_003721457.1.21099 WP_003721457.1.21133 WP_003721457.1.21338 WP_003721457.1.21371 WP_003721457.1.21428 WP_003721457.1.21429 WP_003721457.1.21527 WP_003721457.1.21529 WP_003721457.1.21542 WP_003721457.1.21567 WP_003721457.1.21597 WP_003721457.1.21705 WP_003721457.1.21706 WP_003721457.1.21711 WP_003721457.1.21874 WP_003721457.1.21884 WP_003721457.1.21889 WP_003721457.1.21926 WP_003721457.1.21995 WP_003721457.1.22099 WP_003721457.1.22154 WP_003721457.1.22188 WP_003721457.1.22190 WP_003721457.1.22194 WP_003721457.1.22202 WP_003721457.1.22221 WP_003721457.1.22383 WP_003721457.1.22434 WP_003721457.1.22468 WP_003721457.1.22597 WP_003721457.1.22656 WP_003721457.1.22776 WP_003721457.1.22962 WP_003721457.1.23060 WP_003721457.1.23139 WP_003721457.1.23193 WP_003721457.1.23254 WP_003721457.1.23255 WP_003721457.1.23291 WP_003721457.1.233 WP_003721457.1.2340 WP_003721457.1.23419 WP_003721457.1.23425 WP_003721457.1.23433 WP_003721457.1.23448 WP_003721457.1.23582 WP_003721457.1.23624 WP_003721457.1.23650 WP_003721457.1.2368 WP_003721457.1.23781 WP_003721457.1.23828 WP_003721457.1.23848 WP_003721457.1.24048 WP_003721457.1.24075 WP_003721457.1.24115 WP_003721457.1.2422 WP_003721457.1.24335 WP_003721457.1.24349 WP_003721457.1.24370 WP_003721457.1.24411 WP_003721457.1.24422 WP_003721457.1.24531 WP_003721457.1.24546 WP_003721457.1.24600 WP_003721457.1.24651 WP_003721457.1.24667 WP_003721457.1.24818 WP_003721457.1.24836 WP_003721457.1.24847 WP_003721457.1.24867 WP_003721457.1.24934 WP_003721457.1.24945 WP_003721457.1.24972 WP_003721457.1.24975 WP_003721457.1.25020 WP_003721457.1.25057 WP_003721457.1.25300 WP_003721457.1.25401 WP_003721457.1.2545 WP_003721457.1.25456 WP_003721457.1.25471 WP_003721457.1.25500 WP_003721457.1.25616 WP_003721457.1.25746 WP_003721457.1.25788 WP_003721457.1.25805 WP_003721457.1.25830 WP_003721457.1.25896 WP_003721457.1.26052 WP_003721457.1.26060 WP_003721457.1.26103 WP_003721457.1.26138 WP_003721457.1.26139 WP_003721457.1.26145 WP_003721457.1.26146 WP_003721457.1.26166 WP_003721457.1.26170 WP_003721457.1.26320 WP_003721457.1.26322 WP_003721457.1.26350 WP_003721457.1.26406 WP_003721457.1.26523 WP_003721457.1.2662 WP_003721457.1.26632 WP_003721457.1.26634 WP_003721457.1.2666 WP_003721457.1.26891 WP_003721457.1.26957 WP_003721457.1.27056 WP_003721457.1.27132 WP_003721457.1.27143 WP_003721457.1.27200 WP_003721457.1.27231 WP_003721457.1.27281 WP_003721457.1.27517 WP_003721457.1.27649 WP_003721457.1.27669 WP_003721457.1.27681 WP_003721457.1.27728 WP_003721457.1.27826 WP_003721457.1.27839 WP_003721457.1.27860 WP_003721457.1.27891 WP_003721457.1.27948 WP_003721457.1.28042 WP_003721457.1.28060 WP_003721457.1.28062 WP_003721457.1.28076 WP_003721457.1.28098 WP_003721457.1.28123 WP_003721457.1.2824 WP_003721457.1.28260 WP_003721457.1.28297 WP_003721457.1.2832 WP_003721457.1.28325 WP_003721457.1.28369 WP_003721457.1.28402 WP_003721457.1.2855 WP_003721457.1.28722 WP_003721457.1.28747 WP_003721457.1.28792 WP_003721457.1.28803 WP_003721457.1.28804 WP_003721457.1.28818 WP_003721457.1.29138 WP_003721457.1.2920 WP_003721457.1.29309 WP_003721457.1.29331 WP_003721457.1.29550 WP_003721457.1.29558 WP_003721457.1.29562 WP_003721457.1.29565 WP_003721457.1.29569 WP_003721457.1.29634 WP_003721457.1.29705 WP_003721457.1.29723 WP_003721457.1.29738 WP_003721457.1.29762 WP_003721457.1.29803 WP_003721457.1.29872 WP_003721457.1.29912 WP_003721457.1.30124 WP_003721457.1.30193 WP_003721457.1.30227 WP_003721457.1.30267 WP_003721457.1.30273 WP_003721457.1.30372 WP_003721457.1.30430 WP_003721457.1.305 WP_003721457.1.30660 WP_003721457.1.30706 WP_003721457.1.30827 WP_003721457.1.30837 WP_003721457.1.30851 WP_003721457.1.30882 WP_003721457.1.30902 WP_003721457.1.3103 WP_003721457.1.31062 WP_003721457.1.31108 WP_003721457.1.31116 WP_003721457.1.31289 WP_003721457.1.31305 WP_003721457.1.31329 WP_003721457.1.31444 WP_003721457.1.31485 WP_003721457.1.31584 WP_003721457.1.31691 WP_003721457.1.31702 WP_003721457.1.31830 WP_003721457.1.31966 WP_003721457.1.3206 WP_003721457.1.32061 WP_003721457.1.32140 WP_003721457.1.32209 WP_003721457.1.32210 WP_003721457.1.32240 WP_003721457.1.32278 WP_003721457.1.32402 WP_003721457.1.32472 WP_003721457.1.32597 WP_003721457.1.32622 WP_003721457.1.32648 WP_003721457.1.32681 WP_003721457.1.32698 WP_003721457.1.32767 WP_003721457.1.32817 WP_003721457.1.33016 WP_003721457.1.33039 WP_003721457.1.3314 WP_003721457.1.3324 WP_003721457.1.33240 WP_003721457.1.33282 WP_003721457.1.33336 WP_003721457.1.33591 WP_003721457.1.33688 WP_003721457.1.337 WP_003721457.1.33875 WP_003721457.1.3389 WP_003721457.1.3393 WP_003721457.1.33995 WP_003721457.1.34326 WP_003721457.1.34369 WP_003721457.1.34698 WP_003721457.1.34714 WP_003721457.1.34732 WP_003721457.1.34790 WP_003721457.1.34849 WP_003721457.1.34851 WP_003721457.1.34911 WP_003721457.1.350 WP_003721457.1.3511 WP_003721457.1.35135 WP_003721457.1.35350 WP_003721457.1.35402 WP_003721457.1.35450 WP_003721457.1.35452 WP_003721457.1.35514 WP_003721457.1.35738 WP_003721457.1.35979 WP_003721457.1.36108 WP_003721457.1.36115 WP_003721457.1.3613 WP_003721457.1.36181 WP_003721457.1.36203 WP_003721457.1.36241 WP_003721457.1.364 WP_003721457.1.36582 WP_003721457.1.36599 WP_003721457.1.36749 WP_003721457.1.36877 WP_003721457.1.36936 WP_003721457.1.37023 WP_003721457.1.37278 WP_003721457.1.37426 WP_003721457.1.37466 WP_003721457.1.37471 WP_003721457.1.37518 WP_003721457.1.37561 WP_003721457.1.37665 WP_003721457.1.37723 WP_003721457.1.3782 WP_003721457.1.37882 WP_003721457.1.37900 WP_003721457.1.37927 WP_003721457.1.37951 WP_003721457.1.37986 WP_003721457.1.38015 WP_003721457.1.38025 WP_003721457.1.38076 WP_003721457.1.38150 WP_003721457.1.38224 WP_003721457.1.38281 WP_003721457.1.38302 WP_003721457.1.38382 WP_003721457.1.38396 WP_003721457.1.384 WP_003721457.1.38424 WP_003721457.1.38471 WP_003721457.1.38528 WP_003721457.1.3853 WP_003721457.1.38575 WP_003721457.1.38733 WP_003721457.1.38741 WP_003721457.1.38792 WP_003721457.1.38800 WP_003721457.1.38819 WP_003721457.1.38833 WP_003721457.1.3892 WP_003721457.1.39000 WP_003721457.1.39115 WP_003721457.1.3919 WP_003721457.1.39218 WP_003721457.1.39220 WP_003721457.1.39262 WP_003721457.1.39307 WP_003721457.1.39316 WP_003721457.1.39348 WP_003721457.1.39427 WP_003721457.1.39496 WP_003721457.1.39552 WP_003721457.1.3959 WP_003721457.1.39630 WP_003721457.1.39794 WP_003721457.1.39871 WP_003721457.1.39887 WP_003721457.1.39895 WP_003721457.1.40124 WP_003721457.1.40245 WP_003721457.1.40263 WP_003721457.1.404 WP_003721457.1.40420 WP_003721457.1.405 WP_003721457.1.40504 WP_003721457.1.40556 WP_003721457.1.40580 WP_003721457.1.40720 WP_003721457.1.40841 WP_003721457.1.40953 WP_003721457.1.40976 WP_003721457.1.40978 WP_003721457.1.41023 WP_003721457.1.41222 WP_003721457.1.41281 WP_003721457.1.41337 WP_003721457.1.41348 WP_003721457.1.41603 WP_003721457.1.4166 WP_003721457.1.41700 WP_003721457.1.41876 WP_003721457.1.41903 WP_003721457.1.41909 WP_003721457.1.41955 WP_003721457.1.41970 WP_003721457.1.42010 WP_003721457.1.42040 WP_003721457.1.42089 WP_003721457.1.42127 WP_003721457.1.4218 WP_003721457.1.42310 WP_003721457.1.42317 WP_003721457.1.42339 WP_003721457.1.42525 WP_003721457.1.42550 WP_003721457.1.42564 WP_003721457.1.42615 WP_003721457.1.42616 WP_003721457.1.42672 WP_003721457.1.42926 WP_003721457.1.42958 WP_003721457.1.42994 WP_003721457.1.43060 WP_003721457.1.43135 WP_003721457.1.43267 WP_003721457.1.43280 WP_003721457.1.43304 WP_003721457.1.43327 WP_003721457.1.43336 WP_003721457.1.43350 WP_003721457.1.43458 WP_003721457.1.43480 WP_003721457.1.43619 WP_003721457.1.4371 WP_003721457.1.43768 WP_003721457.1.43807 WP_003721457.1.43916 WP_003721457.1.44023 WP_003721457.1.44092 WP_003721457.1.44106 WP_003721457.1.44147 WP_003721457.1.44161 WP_003721457.1.44230 WP_003721457.1.44427 WP_003721457.1.44596 WP_003721457.1.44645 WP_003721457.1.44663 WP_003721457.1.44703 WP_003721457.1.4472 WP_003721457.1.44749 WP_003721457.1.4479 WP_003721457.1.44806 WP_003721457.1.44897 WP_003721457.1.44924 WP_003721457.1.4503 WP_003721457.1.4510 WP_003721457.1.45295 WP_003721457.1.45309 WP_003721457.1.45355 WP_003721457.1.45512 WP_003721457.1.45524 WP_003721457.1.45541 WP_003721457.1.4557 WP_003721457.1.4562 WP_003721457.1.45708 WP_003721457.1.45719 WP_003721457.1.45758 WP_003721457.1.45759 WP_003721457.1.45778 WP_003721457.1.4578 WP_003721457.1.45803 WP_003721457.1.45811 WP_003721457.1.4587 WP_003721457.1.45877 WP_003721457.1.45883 WP_003721457.1.45893 WP_003721457.1.45983 WP_003721457.1.45994 WP_003721457.1.4604 WP_003721457.1.46045 WP_003721457.1.46064 WP_003721457.1.4615 WP_003721457.1.46154 WP_003721457.1.46180 WP_003721457.1.46277 WP_003721457.1.46314 WP_003721457.1.4642 WP_003721457.1.46425 WP_003721457.1.46456 WP_003721457.1.46566 WP_003721457.1.46653 WP_003721457.1.46725 WP_003721457.1.46834 WP_003721457.1.46863 WP_003721457.1.46867 WP_003721457.1.46883 WP_003721457.1.46981 WP_003721457.1.47001 WP_003721457.1.47055 WP_003721457.1.47075 WP_003721457.1.47203 WP_003721457.1.47384 WP_003721457.1.47412 WP_003721457.1.47431 WP_003721457.1.47518 WP_003721457.1.47520 WP_003721457.1.4753 WP_003721457.1.47593 WP_003721457.1.47650 WP_003721457.1.4766 WP_003721457.1.47738 WP_003721457.1.47759 WP_003721457.1.47952 WP_003721457.1.47953 WP_003721457.1.47979 WP_003721457.1.48007 WP_003721457.1.48161 WP_003721457.1.48163 WP_003721457.1.48175 WP_003721457.1.48180 WP_003721457.1.48235 WP_003721457.1.48358 WP_003721457.1.48410 WP_003721457.1.48435 WP_003721457.1.48440 WP_003721457.1.48441 WP_003721457.1.48471 WP_003721457.1.48565 WP_003721457.1.48572 WP_003721457.1.48624 WP_003721457.1.48661 WP_003721457.1.48854 WP_003721457.1.48999 WP_003721457.1.49 WP_003721457.1.49146 WP_003721457.1.49202 WP_003721457.1.49205 WP_003721457.1.49390 WP_003721457.1.49391 WP_003721457.1.49415 WP_003721457.1.49458 WP_003721457.1.49467 WP_003721457.1.49507 WP_003721457.1.49604 WP_003721457.1.49668 WP_003721457.1.49708 WP_003721457.1.4974 WP_003721457.1.49754 WP_003721457.1.49952 WP_003721457.1.49962 WP_003721457.1.50044 WP_003721457.1.50063 WP_003721457.1.50073 WP_003721457.1.5020 WP_003721457.1.50236 WP_003721457.1.50237 WP_003721457.1.50243 WP_003721457.1.50288 WP_003721457.1.50293 WP_003721457.1.50334 WP_003721457.1.50482 WP_003721457.1.50662 WP_003721457.1.50765 WP_003721457.1.50775 WP_003721457.1.50862 WP_003721457.1.50883 WP_003721457.1.50888 WP_003721457.1.50898 WP_003721457.1.50926 WP_003721457.1.50971 WP_003721457.1.5099 WP_003721457.1.51086 WP_003721457.1.51262 WP_003721457.1.5129 WP_003721457.1.51318 WP_003721457.1.51384 WP_003721457.1.51435 WP_003721457.1.51493 WP_003721457.1.51510 WP_003721457.1.51650 WP_003721457.1.5170 WP_003721457.1.51720 WP_003721457.1.51732 WP_003721457.1.5175 WP_003721457.1.51768 WP_003721457.1.51980 WP_003721457.1.52142 WP_003721457.1.52177 WP_003721457.1.52290 WP_003721457.1.52371 WP_003721457.1.52395 WP_003721457.1.52420 WP_003721457.1.52447 WP_003721457.1.52507 WP_003721457.1.52617 WP_003721457.1.52684 WP_003721457.1.52725 WP_003721457.1.52782 WP_003721457.1.52829 WP_003721457.1.52867 WP_003721457.1.52989 WP_003721457.1.53051 WP_003721457.1.53102 WP_003721457.1.53161 WP_003721457.1.5317 WP_003721457.1.53193 WP_003721457.1.53266 WP_003721457.1.53378 WP_003721457.1.53426 WP_003721457.1.53536 WP_003721457.1.53566 WP_003721457.1.53603 WP_003721457.1.53807 WP_003721457.1.53870 WP_003721457.1.53877 WP_003721457.1.53920 WP_003721457.1.54046 WP_003721457.1.54160 WP_003721457.1.5417 WP_003721457.1.54181 WP_003721457.1.54434 WP_003721457.1.54505 WP_003721457.1.54506 WP_003721457.1.54508 WP_003721457.1.54564 WP_003721457.1.54639 WP_003721457.1.54646 WP_003721457.1.5472 WP_003721457.1.54740 WP_003721457.1.54750 WP_003721457.1.54884 WP_003721457.1.54890 WP_003721457.1.55027 WP_003721457.1.55068 WP_003721457.1.5514 WP_003721457.1.55231 WP_003721457.1.55238 WP_003721457.1.5538 WP_003721457.1.55386 WP_003721457.1.55423 WP_003721457.1.55487 WP_003721457.1.55494 WP_003721457.1.55510 WP_003721457.1.55609 WP_003721457.1.55740 WP_003721457.1.55797 WP_003721457.1.55824 WP_003721457.1.55847 WP_003721457.1.55850 WP_003721457.1.55890 WP_003721457.1.5601 WP_003721457.1.56269 WP_003721457.1.5631 WP_003721457.1.56322 WP_003721457.1.56344 WP_003721457.1.56415 WP_003721457.1.56526 WP_003721457.1.56557 WP_003721457.1.56566 WP_003721457.1.5671 WP_003721457.1.56748 WP_003721457.1.56759 WP_003721457.1.5687 WP_003721457.1.56923 WP_003721457.1.57106 WP_003721457.1.57132 WP_003721457.1.57171 WP_003721457.1.57228 WP_003721457.1.57374 WP_003721457.1.57404 WP_003721457.1.57504 WP_003721457.1.57505 WP_003721457.1.57536 WP_003721457.1.57547 WP_003721457.1.57578 WP_003721457.1.57625 WP_003721457.1.57766 WP_003721457.1.57913 WP_003721457.1.57932 WP_003721457.1.57948 WP_003721457.1.57963 WP_003721457.1.57979 WP_003721457.1.58 WP_003721457.1.58030 WP_003721457.1.58069 WP_003721457.1.58083 WP_003721457.1.58088 WP_003721457.1.58177 WP_003721457.1.58491 WP_003721457.1.58516 WP_003721457.1.58532 WP_003721457.1.58544 WP_003721457.1.58661 WP_003721457.1.58828 WP_003721457.1.58966 WP_003721457.1.59045 WP_003721457.1.59113 WP_003721457.1.59343 WP_003721457.1.59353 WP_003721457.1.59477 WP_003721457.1.59493 WP_003721457.1.59542 WP_003721457.1.59652 WP_003721457.1.59695 WP_003721457.1.59720 WP_003721457.1.5973 WP_003721457.1.59744 WP_003721457.1.59799 WP_003721457.1.59826 WP_003721457.1.59937 WP_003721457.1.59949 WP_003721457.1.59975 WP_003721457.1.59984 WP_003721457.1.60132 WP_003721457.1.60162 WP_003721457.1.60166 WP_003721457.1.60191 WP_003721457.1.60219 WP_003721457.1.60258 WP_003721457.1.60295 WP_003721457.1.60297 WP_003721457.1.60346 WP_003721457.1.60369 WP_003721457.1.60543 WP_003721457.1.60665 WP_003721457.1.60674 WP_003721457.1.60762 WP_003721457.1.60766 WP_003721457.1.60768 WP_003721457.1.60956 WP_003721457.1.61002 WP_003721457.1.61072 WP_003721457.1.611 WP_003721457.1.61109 WP_003721457.1.61244 WP_003721457.1.61274 WP_003721457.1.61358 WP_003721457.1.61371 WP_003721457.1.61384 WP_003721457.1.61525 WP_003721457.1.61824 WP_003721457.1.61894 WP_003721457.1.61915 WP_003721457.1.62177 WP_003721457.1.6236 WP_003721457.1.62375 WP_003721457.1.62430 WP_003721457.1.62494 WP_003721457.1.62573 WP_003721457.1.62629 WP_003721457.1.62655 WP_003721457.1.62663 WP_003721457.1.62690 WP_003721457.1.6281 WP_003721457.1.62852 WP_003721457.1.62874 WP_003721457.1.62904 WP_003721457.1.62972 WP_003721457.1.63209 WP_003721457.1.63269 WP_003721457.1.63283 WP_003721457.1.63315 WP_003721457.1.63359 WP_003721457.1.63605 WP_003721457.1.63676 WP_003721457.1.63842 WP_003721457.1.63883 WP_003721457.1.63932 WP_003721457.1.63951 WP_003721457.1.6397 WP_003721457.1.64041 WP_003721457.1.64147 WP_003721457.1.64200 WP_003721457.1.64227 WP_003721457.1.64259 WP_003721457.1.64289 WP_003721457.1.64413 WP_003721457.1.64531 WP_003721457.1.64587 WP_003721457.1.6460 WP_003721457.1.64796 WP_003721457.1.648 WP_003721457.1.64869 WP_003721457.1.64929 WP_003721457.1.65094 WP_003721457.1.65143 WP_003721457.1.65213 WP_003721457.1.65309 WP_003721457.1.65376 WP_003721457.1.65392 WP_003721457.1.65561 WP_003721457.1.65730 WP_003721457.1.65780 WP_003721457.1.6579 WP_003721457.1.65827 WP_003721457.1.65840 WP_003721457.1.65913 WP_003721457.1.66039 WP_003721457.1.66057 WP_003721457.1.66134 WP_003721457.1.66138 WP_003721457.1.66184 WP_003721457.1.66285 WP_003721457.1.66296 WP_003721457.1.66311 WP_003721457.1.66338 WP_003721457.1.66510 WP_003721457.1.66512 WP_003721457.1.66545 WP_003721457.1.66596 WP_003721457.1.6672 WP_003721457.1.66743 WP_003721457.1.66884 WP_003721457.1.66903 WP_003721457.1.66993 WP_003721457.1.67165 WP_003721457.1.67301 WP_003721457.1.6731 WP_003721457.1.67352 WP_003721457.1.67408 WP_003721457.1.67429 WP_003721457.1.6745 WP_003721457.1.67551 WP_003721457.1.67573 WP_003721457.1.67610 WP_003721457.1.6763 WP_003721457.1.67654 WP_003721457.1.67668 WP_003721457.1.67694 WP_003721457.1.67709 WP_003721457.1.67795 WP_003721457.1.67813 WP_003721457.1.67884 WP_003721457.1.67926 WP_003721457.1.68112 WP_003721457.1.68123 WP_003721457.1.68128 WP_003721457.1.68197 WP_003721457.1.68208 WP_003721457.1.68236 WP_003721457.1.68282 WP_003721457.1.68301 WP_003721457.1.68321 WP_003721457.1.68414 WP_003721457.1.68497 WP_003721457.1.68517 WP_003721457.1.68525 WP_003721457.1.68528 WP_003721457.1.68740 WP_003721457.1.69190 WP_003721457.1.69263 WP_003721457.1.69265 WP_003721457.1.69360 WP_003721457.1.69471 WP_003721457.1.69570 WP_003721457.1.69579 WP_003721457.1.69587 WP_003721457.1.69603 WP_003721457.1.69631 WP_003721457.1.69727 WP_003721457.1.69764 WP_003721457.1.6982 WP_003721457.1.69864 WP_003721457.1.6991 WP_003721457.1.69989 WP_003721457.1.70100 WP_003721457.1.70104 WP_003721457.1.70122 WP_003721457.1.7026 WP_003721457.1.70309 WP_003721457.1.7031 WP_003721457.1.70373 WP_003721457.1.7051 WP_003721457.1.70588 WP_003721457.1.70590 WP_003721457.1.70633 WP_003721457.1.70690 WP_003721457.1.70736 WP_003721457.1.70992 WP_003721457.1.71328 WP_003721457.1.71381 WP_003721457.1.71437 WP_003721457.1.71474 WP_003721457.1.71585 WP_003721457.1.71726 WP_003721457.1.7175 WP_003721457.1.71753 WP_003721457.1.71763 WP_003721457.1.71858 WP_003721457.1.71904 WP_003721457.1.71921 WP_003721457.1.72051 WP_003721457.1.72057 WP_003721457.1.72116 WP_003721457.1.7218 WP_003721457.1.72228 WP_003721457.1.72264 WP_003721457.1.72370 WP_003721457.1.72385 WP_003721457.1.72467 WP_003721457.1.72546 WP_003721457.1.72558 WP_003721457.1.72566 WP_003721457.1.72623 WP_003721457.1.72636 WP_003721457.1.72813 WP_003721457.1.72841 WP_003721457.1.72886 WP_003721457.1.72918 WP_003721457.1.73152 WP_003721457.1.73222 WP_003721457.1.73263 WP_003721457.1.734 WP_003721457.1.73448 WP_003721457.1.73458 WP_003721457.1.73508 WP_003721457.1.73545 WP_003721457.1.73613 WP_003721457.1.73656 WP_003721457.1.73769 WP_003721457.1.74095 WP_003721457.1.74148 WP_003721457.1.7421 WP_003721457.1.74217 WP_003721457.1.74290 WP_003721457.1.74303 WP_003721457.1.74351 WP_003721457.1.74436 WP_003721457.1.74450 WP_003721457.1.7454 WP_003721457.1.74572 WP_003721457.1.74617 WP_003721457.1.74728 WP_003721457.1.74754 WP_003721457.1.74823 WP_003721457.1.74837 WP_003721457.1.74927 WP_003721457.1.74956 WP_003721457.1.7498 WP_003721457.1.7504 WP_003721457.1.75069 WP_003721457.1.75072 WP_003721457.1.75196 WP_003721457.1.75216 WP_003721457.1.75240 WP_003721457.1.7528 WP_003721457.1.7553 WP_003721457.1.75541 WP_003721457.1.75548 WP_003721457.1.75604 WP_003721457.1.75624 WP_003721457.1.7565 WP_003721457.1.75670 WP_003721457.1.75838 WP_003721457.1.75869 WP_003721457.1.75923 WP_003721457.1.76094 WP_003721457.1.76120 WP_003721457.1.76124 WP_003721457.1.76168 WP_003721457.1.76247 WP_003721457.1.76254 WP_003721457.1.76367 WP_003721457.1.76545 WP_003721457.1.76608 WP_003721457.1.76769 WP_003721457.1.76926 WP_003721457.1.76982 WP_003721457.1.77116 WP_003721457.1.77149 WP_003721457.1.7718 WP_003721457.1.77191 WP_003721457.1.77192 WP_003721457.1.77222 WP_003721457.1.77246 WP_003721457.1.77261 WP_003721457.1.77345 WP_003721457.1.77350 WP_003721457.1.7736 WP_003721457.1.77376 WP_003721457.1.7738 WP_003721457.1.77389 WP_003721457.1.77420 WP_003721457.1.77594 WP_003721457.1.77675 WP_003721457.1.77681 WP_003721457.1.77697 WP_003721457.1.77720 WP_003721457.1.77823 WP_003721457.1.77849 WP_003721457.1.77928 WP_003721457.1.77943 WP_003721457.1.78088 WP_003721457.1.78121 WP_003721457.1.78130 WP_003721457.1.78167 WP_003721457.1.78203 WP_003721457.1.78315 WP_003721457.1.7832 WP_003721457.1.78328 WP_003721457.1.78525 WP_003721457.1.78681 WP_003721457.1.78717 WP_003721457.1.79128 WP_003721457.1.79149 WP_003721457.1.79184 WP_003721457.1.79212 WP_003721457.1.79259 WP_003721457.1.79295 WP_003721457.1.7932 WP_003721457.1.79351 WP_003721457.1.79434 WP_003721457.1.79458 WP_003721457.1.79602 WP_003721457.1.79803 WP_003721457.1.79821 WP_003721457.1.79962 WP_003721457.1.79964 WP_003721457.1.80028 WP_003721457.1.80036 WP_003721457.1.80088 WP_003721457.1.80105 WP_003721457.1.80514 WP_003721457.1.80693 WP_003721457.1.80790 WP_003721457.1.80896 WP_003721457.1.80968 WP_003721457.1.81140 WP_003721457.1.81261 WP_003721457.1.81270 WP_003721457.1.81315 WP_003721457.1.81476 WP_003721457.1.81495 WP_003721457.1.81503 WP_003721457.1.8151 WP_003721457.1.81647 WP_003721457.1.81662 WP_003721457.1.81693 WP_003721457.1.81725 WP_003721457.1.81833 WP_003721457.1.81863 WP_003721457.1.82274 WP_003721457.1.82294 WP_003721457.1.82372 WP_003721457.1.82440 WP_003721457.1.82480 WP_003721457.1.82605 WP_003721457.1.82616 WP_003721457.1.82662 WP_003721457.1.82667 WP_003721457.1.82719 WP_003721457.1.82821 WP_003721457.1.82893 WP_003721457.1.82951 WP_003721457.1.82974 WP_003721457.1.83015 WP_003721457.1.83030 WP_003721457.1.83121 WP_003721457.1.83130 WP_003721457.1.83137 WP_003721457.1.83215 WP_003721457.1.83217 WP_003721457.1.83236 WP_003721457.1.83260 WP_003721457.1.83323 WP_003721457.1.83350 WP_003721457.1.83478 WP_003721457.1.83542 WP_003721457.1.83546 WP_003721457.1.83607 WP_003721457.1.83755 WP_003721457.1.83809 WP_003721457.1.83877 WP_003721457.1.83907 WP_003721457.1.8391 WP_003721457.1.83932 WP_003721457.1.8418 WP_003721457.1.84180 WP_003721457.1.84265 WP_003721457.1.84320 WP_003721457.1.84367 WP_003721457.1.84539 WP_003721457.1.84579 WP_003721457.1.84586 WP_003721457.1.84588 WP_003721457.1.8460 WP_003721457.1.8465 WP_003721457.1.8473 WP_003721457.1.84781 WP_003721457.1.84833 WP_003721457.1.84895 WP_003721457.1.84974 WP_003721457.1.84980 WP_003721457.1.85036 WP_003721457.1.85037 WP_003721457.1.85172 WP_003721457.1.85194 WP_003721457.1.85317 WP_003721457.1.85321 WP_003721457.1.8539 WP_003721457.1.85576 WP_003721457.1.85690 WP_003721457.1.85887 WP_003721457.1.85890 WP_003721457.1.8593 WP_003721457.1.86056 WP_003721457.1.86091 WP_003721457.1.86098 WP_003721457.1.86232 WP_003721457.1.86253 WP_003721457.1.86279 WP_003721457.1.86308 WP_003721457.1.86484 WP_003721457.1.86571 WP_003721457.1.86597 WP_003721457.1.866 WP_003721457.1.86683 WP_003721457.1.86752 WP_003721457.1.86958 WP_003721457.1.87085 WP_003721457.1.8710 WP_003721457.1.87101 WP_003721457.1.87108 WP_003721457.1.8715 WP_003721457.1.87154 WP_003721457.1.87179 WP_003721457.1.87294 WP_003721457.1.87328 WP_003721457.1.87329 WP_003721457.1.87436 WP_003721457.1.87536 WP_003721457.1.87537 WP_003721457.1.87701 WP_003721457.1.87794 WP_003721457.1.8782 WP_003721457.1.87890 WP_003721457.1.87903 WP_003721457.1.87920 WP_003721457.1.88015 WP_003721457.1.88055 WP_003721457.1.88063 WP_003721457.1.88112 WP_003721457.1.88128 WP_003721457.1.88211 WP_003721457.1.88397 WP_003721457.1.88422 WP_003721457.1.88463 WP_003721457.1.88485 WP_003721457.1.88584 WP_003721457.1.88589 WP_003721457.1.88639 WP_003721457.1.88768 WP_003721457.1.88783 WP_003721457.1.88800 WP_003721457.1.88806 WP_003721457.1.8884 WP_003721457.1.88877 WP_003721457.1.88890 WP_003721457.1.88895 WP_003721457.1.88974 WP_003721457.1.89014 WP_003721457.1.89085 WP_003721457.1.89127 WP_003721457.1.89160 WP_003721457.1.89267 WP_003721457.1.89302 WP_003721457.1.8932 WP_003721457.1.89386 WP_003721457.1.89387 WP_003721457.1.89443 WP_003721457.1.89450 WP_003721457.1.89478 WP_003721457.1.89505 WP_003721457.1.89756 WP_003721457.1.89809 WP_003721457.1.89812 WP_003721457.1.8988 WP_003721457.1.89897 WP_003721457.1.89916 WP_003721457.1.89969 WP_003721457.1.90086 WP_003721457.1.90135 WP_003721457.1.9019 WP_003721457.1.90201 WP_003721457.1.90212 WP_003721457.1.90326 WP_003721457.1.90459 WP_003721457.1.90524 WP_003721457.1.90567 WP_003721457.1.90645 WP_003721457.1.90646 WP_003721457.1.90741 WP_003721457.1.90772 WP_003721457.1.90821 WP_003721457.1.90829 WP_003721457.1.90857 WP_003721457.1.90963 WP_003721457.1.91084 WP_003721457.1.9109 WP_003721457.1.91140 WP_003721457.1.91168 WP_003721457.1.91195 WP_003721457.1.91212 WP_003721457.1.91443 WP_003721457.1.91514 WP_003721457.1.91556 WP_003721457.1.91560 WP_003721457.1.91765 WP_003721457.1.91920 WP_003721457.1.91922 WP_003721457.1.92049 WP_003721457.1.92132 WP_003721457.1.92142 WP_003721457.1.92148 WP_003721457.1.92274 WP_003721457.1.92288 WP_003721457.1.92370 WP_003721457.1.92409 WP_003721457.1.9243 WP_003721457.1.92494 WP_003721457.1.92548 WP_003721457.1.92591 WP_003721457.1.92595 WP_003721457.1.9282 WP_003721457.1.92928 WP_003721457.1.92963 WP_003721457.1.93014 WP_003721457.1.93049 WP_003721457.1.93217 WP_003721457.1.93325 WP_003721457.1.93421 WP_003721457.1.93490 WP_003721457.1.93534 WP_003721457.1.93556 WP_003721457.1.93558 WP_003721457.1.93611 WP_003721457.1.93712 WP_003721457.1.93777 WP_003721457.1.93859 WP_003721457.1.93867 WP_003721457.1.93895 WP_003721457.1.93920 WP_003721457.1.93997 WP_003721457.1.94026 WP_003721457.1.94032 WP_003721457.1.94058 WP_003721457.1.94059 WP_003721457.1.94081 WP_003721457.1.94191 WP_003721457.1.94206 WP_003721457.1.94225 WP_003721457.1.94233 WP_003721457.1.94336 WP_003721457.1.94401 WP_003721457.1.94431 WP_003721457.1.94447 WP_003721457.1.94464 WP_003721457.1.94499 WP_003721457.1.94537 WP_003721457.1.94554 WP_003721457.1.94613 WP_003721457.1.94758 WP_003721457.1.94759 WP_003721457.1.94795 WP_003721457.1.94906 WP_003721457.1.94961 WP_003721457.1.9502 WP_003721457.1.9505 WP_003721457.1.95100 WP_003721457.1.95146 WP_003721457.1.95162 WP_003721457.1.9517 WP_003721457.1.95186 WP_003721457.1.95197 WP_003721457.1.95256 WP_003721457.1.95696 WP_003721457.1.95702 WP_003721457.1.95715 WP_003721457.1.95945 WP_003721457.1.96033 WP_003721457.1.96084 WP_003721457.1.96140 WP_003721457.1.96156 WP_003721457.1.96296 WP_003721457.1.96308 WP_003721457.1.96407 WP_003721457.1.96422 WP_003721457.1.9643 WP_003721457.1.96438 WP_003721457.1.96449 WP_003721457.1.96496 WP_003721457.1.96542 WP_003721457.1.96544 WP_003721457.1.96586 WP_003721457.1.96596 WP_003721457.1.96605 WP_003721457.1.96708 WP_003721457.1.9672 WP_003721457.1.96751 WP_003721457.1.96835 WP_003721457.1.96867 WP_003721457.1.96874 WP_003721457.1.96940 WP_003721457.1.97140 WP_003721457.1.97165 WP_003721457.1.97199 WP_003721457.1.97257 WP_003721457.1.97315 WP_003721457.1.9732 WP_003721457.1.97378 WP_003721457.1.97390 WP_003721457.1.97469 WP_003721457.1.97569 WP_003721457.1.97587 WP_003721457.1.97589 WP_003721457.1.97633 WP_003721457.1.9768 WP_003721457.1.9769 WP_003721457.1.97752 WP_003721457.1.97803 WP_003721457.1.97820 WP_003721457.1.97900 WP_003721457.1.97970 WP_003721457.1.9802 WP_003721457.1.98038 WP_003721457.1.98042 WP_003721457.1.98060 WP_003721457.1.98193 WP_003721457.1.98331 WP_003721457.1.98351 WP_003721457.1.98375 WP_003721457.1.9840 WP_003721457.1.98490 WP_003721457.1.98689 WP_003721457.1.98826 WP_003721457.1.98829 WP_003721457.1.98866 WP_003721457.1.9894 WP_003721457.1.98974 WP_003721457.1.99026 WP_003721457.1.99125 WP_003721457.1.99199 WP_003721457.1.99357 WP_003721457.1.99409 WP_003721457.1.99480 WP_003721457.1.99512 WP_003721457.1.99518 WP_003721457.1.99520 WP_003721457.1.99521 WP_003721457.1.99527 WP_003721457.1.99553 WP_003721457.1.99568 WP_003721457.1.99663 WP_003721457.1.99702 WP_003721457.1.99737 WP_003721457.1.99785 WP_003721457.1.99786 WP_003721457.1.99818 WP_003721457.1.99836 WP_003721457.1.99914 WP_003721457.1.99921 WP_003721457.1.99974 gi|404407342|ref|YP_006690057.1| gi|386026210|ref|YP_005946986.1| gi|284801220|ref|YP_003413085.1| gi|424713769|ref|YP_007014484.1| gi|405757887|ref|YP_006687163.1| gi|404410130|ref|YP_006695718.1| gi|46907122|ref|YP_013511.1| 169963.lmo0890 265669.LMOf2365_0909 272626.lin0889 386043.lwe0872 552536.LMHCC_1736 634178.Lm4b_00908 gi|405749244|ref|YP_006672710.1| gi|404412974|ref|YP_006698561.1| gi|284994362|ref|YP_003416130.1| gi|386046552|ref|YP_005964884.1| gi|16799962|ref|NP_470230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]