SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 171101.spr0101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  171101.spr0101
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.38e-68
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 171101.spr0101
Sequence length 265
Comment (Streptococcus pneumoniae R6)
Sequence
MKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQI
VGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTP
YYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLI
TDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDK
TIQKLKESGELDKLIEDAFKASIEK
Download sequence
Identical sequences Q8DRI6
gi|15902145|ref|NP_357695.1| NP_357695.1.60829 WP_010976383.1.41047 171101.spr0101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]