SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 176279.SERP1141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176279.SERP1141
Domain Number 1 Region: 172-234
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000445
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176279.SERP1141
Sequence length 236
Comment (Staphylococcus epidermidis RP62A)
Sequence
MDNLHLIHMLFMAKPLNGMNWVENLAQFITQPFVSLIFTCIIFIGFLYQLYSKRINLMGI
IALLALLLLFLAFLINGDVNVMSVLLFTIGLILLIVELFVIGAVIGIIGIILITLSIIIL
GDNILLMLGNVIVALILSIVEWVILVKIFNRKIPFLDKVILKDSTNSEAGYRSHDDRSHL
VGKTAHTVTDLRPAGIITCDNDRIDAVSDGSFILRNRQVKILEVEGTRVVVREIEK
Download sequence
Identical sequences A0A0H2VIV4 A0A0Y1XGY2 A0A1U3SEY6 A0A2G7IZ80 D4FJ10 Q5HNX3 W1WL40
176279.SERP1141 176280.SE1261 gi|57867023|ref|YP_188717.1| gi|27468179|ref|NP_764816.1| NP_764816.1.96214 WP_001831053.1.100050 WP_001831053.1.10021 WP_001831053.1.100433 WP_001831053.1.100549 WP_001831053.1.100800 WP_001831053.1.101292 WP_001831053.1.101732 WP_001831053.1.10200 WP_001831053.1.10516 WP_001831053.1.1064 WP_001831053.1.1066 WP_001831053.1.10880 WP_001831053.1.11039 WP_001831053.1.11097 WP_001831053.1.11264 WP_001831053.1.1172 WP_001831053.1.11988 WP_001831053.1.12195 WP_001831053.1.12254 WP_001831053.1.12399 WP_001831053.1.12601 WP_001831053.1.12633 WP_001831053.1.13547 WP_001831053.1.13713 WP_001831053.1.13993 WP_001831053.1.1487 WP_001831053.1.14999 WP_001831053.1.15050 WP_001831053.1.15264 WP_001831053.1.15608 WP_001831053.1.15634 WP_001831053.1.15776 WP_001831053.1.15796 WP_001831053.1.15975 WP_001831053.1.16031 WP_001831053.1.16425 WP_001831053.1.16888 WP_001831053.1.1734 WP_001831053.1.17536 WP_001831053.1.17589 WP_001831053.1.1780 WP_001831053.1.17932 WP_001831053.1.18322 WP_001831053.1.18738 WP_001831053.1.18820 WP_001831053.1.18924 WP_001831053.1.19169 WP_001831053.1.19525 WP_001831053.1.19634 WP_001831053.1.19747 WP_001831053.1.20222 WP_001831053.1.20605 WP_001831053.1.20829 WP_001831053.1.2143 WP_001831053.1.22029 WP_001831053.1.2266 WP_001831053.1.22744 WP_001831053.1.2308 WP_001831053.1.23129 WP_001831053.1.23748 WP_001831053.1.23933 WP_001831053.1.2398 WP_001831053.1.23999 WP_001831053.1.24537 WP_001831053.1.24864 WP_001831053.1.25104 WP_001831053.1.25359 WP_001831053.1.2587 WP_001831053.1.26079 WP_001831053.1.26136 WP_001831053.1.26728 WP_001831053.1.26763 WP_001831053.1.26887 WP_001831053.1.27014 WP_001831053.1.27020 WP_001831053.1.27021 WP_001831053.1.27243 WP_001831053.1.27273 WP_001831053.1.27634 WP_001831053.1.2771 WP_001831053.1.27842 WP_001831053.1.27875 WP_001831053.1.28189 WP_001831053.1.28279 WP_001831053.1.29015 WP_001831053.1.29043 WP_001831053.1.29412 WP_001831053.1.29900 WP_001831053.1.30044 WP_001831053.1.30228 WP_001831053.1.30361 WP_001831053.1.30590 WP_001831053.1.31449 WP_001831053.1.31487 WP_001831053.1.32007 WP_001831053.1.32060 WP_001831053.1.32657 WP_001831053.1.33089 WP_001831053.1.33508 WP_001831053.1.33701 WP_001831053.1.34082 WP_001831053.1.34374 WP_001831053.1.34705 WP_001831053.1.34758 WP_001831053.1.35206 WP_001831053.1.35778 WP_001831053.1.36104 WP_001831053.1.36293 WP_001831053.1.36528 WP_001831053.1.36840 WP_001831053.1.3698 WP_001831053.1.37090 WP_001831053.1.3735 WP_001831053.1.37506 WP_001831053.1.37572 WP_001831053.1.37668 WP_001831053.1.37755 WP_001831053.1.38090 WP_001831053.1.38123 WP_001831053.1.38296 WP_001831053.1.38364 WP_001831053.1.38568 WP_001831053.1.3910 WP_001831053.1.39158 WP_001831053.1.39520 WP_001831053.1.39993 WP_001831053.1.40006 WP_001831053.1.40194 WP_001831053.1.40309 WP_001831053.1.40408 WP_001831053.1.40535 WP_001831053.1.40661 WP_001831053.1.40934 WP_001831053.1.41570 WP_001831053.1.4163 WP_001831053.1.41640 WP_001831053.1.42083 WP_001831053.1.42133 WP_001831053.1.42501 WP_001831053.1.42781 WP_001831053.1.430 WP_001831053.1.43129 WP_001831053.1.43309 WP_001831053.1.43463 WP_001831053.1.43835 WP_001831053.1.44120 WP_001831053.1.44564 WP_001831053.1.44582 WP_001831053.1.44772 WP_001831053.1.45071 WP_001831053.1.45275 WP_001831053.1.45314 WP_001831053.1.45384 WP_001831053.1.45401 WP_001831053.1.45409 WP_001831053.1.45515 WP_001831053.1.45625 WP_001831053.1.45766 WP_001831053.1.45985 WP_001831053.1.46159 WP_001831053.1.46517 WP_001831053.1.46580 WP_001831053.1.46639 WP_001831053.1.4677 WP_001831053.1.46800 WP_001831053.1.47347 WP_001831053.1.47465 WP_001831053.1.4806 WP_001831053.1.48269 WP_001831053.1.48665 WP_001831053.1.48672 WP_001831053.1.50086 WP_001831053.1.50102 WP_001831053.1.50141 WP_001831053.1.50545 WP_001831053.1.51168 WP_001831053.1.5131 WP_001831053.1.51353 WP_001831053.1.51852 WP_001831053.1.52629 WP_001831053.1.53182 WP_001831053.1.53858 WP_001831053.1.54233 WP_001831053.1.54624 WP_001831053.1.55205 WP_001831053.1.55394 WP_001831053.1.5653 WP_001831053.1.56880 WP_001831053.1.57396 WP_001831053.1.57676 WP_001831053.1.57912 WP_001831053.1.57980 WP_001831053.1.58205 WP_001831053.1.58920 WP_001831053.1.59220 WP_001831053.1.59429 WP_001831053.1.59612 WP_001831053.1.59696 WP_001831053.1.60263 WP_001831053.1.604 WP_001831053.1.60471 WP_001831053.1.60968 WP_001831053.1.61134 WP_001831053.1.61490 WP_001831053.1.62056 WP_001831053.1.62209 WP_001831053.1.62552 WP_001831053.1.63141 WP_001831053.1.63199 WP_001831053.1.63339 WP_001831053.1.63714 WP_001831053.1.64636 WP_001831053.1.64836 WP_001831053.1.65535 WP_001831053.1.65731 WP_001831053.1.65823 WP_001831053.1.66623 WP_001831053.1.66725 WP_001831053.1.67105 WP_001831053.1.67262 WP_001831053.1.67413 WP_001831053.1.67493 WP_001831053.1.68211 WP_001831053.1.68456 WP_001831053.1.68665 WP_001831053.1.687 WP_001831053.1.69187 WP_001831053.1.69281 WP_001831053.1.69584 WP_001831053.1.69585 WP_001831053.1.69743 WP_001831053.1.70385 WP_001831053.1.70534 WP_001831053.1.70703 WP_001831053.1.70714 WP_001831053.1.70755 WP_001831053.1.71072 WP_001831053.1.71096 WP_001831053.1.7127 WP_001831053.1.72059 WP_001831053.1.72202 WP_001831053.1.72358 WP_001831053.1.7287 WP_001831053.1.72908 WP_001831053.1.72948 WP_001831053.1.73003 WP_001831053.1.73271 WP_001831053.1.7393 WP_001831053.1.74694 WP_001831053.1.75068 WP_001831053.1.75166 WP_001831053.1.75383 WP_001831053.1.75578 WP_001831053.1.75757 WP_001831053.1.76151 WP_001831053.1.76766 WP_001831053.1.7796 WP_001831053.1.78204 WP_001831053.1.78266 WP_001831053.1.78514 WP_001831053.1.78749 WP_001831053.1.79009 WP_001831053.1.79087 WP_001831053.1.79415 WP_001831053.1.79632 WP_001831053.1.79856 WP_001831053.1.80118 WP_001831053.1.80285 WP_001831053.1.80311 WP_001831053.1.80313 WP_001831053.1.80534 WP_001831053.1.80584 WP_001831053.1.81223 WP_001831053.1.81326 WP_001831053.1.81614 WP_001831053.1.81804 WP_001831053.1.81818 WP_001831053.1.82021 WP_001831053.1.82163 WP_001831053.1.82199 WP_001831053.1.82273 WP_001831053.1.82303 WP_001831053.1.8237 WP_001831053.1.82807 WP_001831053.1.83976 WP_001831053.1.84232 WP_001831053.1.84248 WP_001831053.1.8443 WP_001831053.1.84545 WP_001831053.1.85164 WP_001831053.1.85372 WP_001831053.1.85545 WP_001831053.1.85735 WP_001831053.1.85851 WP_001831053.1.86219 WP_001831053.1.86391 WP_001831053.1.87036 WP_001831053.1.87531 WP_001831053.1.87968 WP_001831053.1.88153 WP_001831053.1.88436 WP_001831053.1.8850 WP_001831053.1.88657 WP_001831053.1.88681 WP_001831053.1.8890 WP_001831053.1.89058 WP_001831053.1.89239 WP_001831053.1.89313 WP_001831053.1.89535 WP_001831053.1.89842 WP_001831053.1.89877 WP_001831053.1.90573 WP_001831053.1.910 WP_001831053.1.91028 WP_001831053.1.91726 WP_001831053.1.91956 WP_001831053.1.92120 WP_001831053.1.92296 WP_001831053.1.92313 WP_001831053.1.92414 WP_001831053.1.92919 WP_001831053.1.92977 WP_001831053.1.93985 WP_001831053.1.94055 WP_001831053.1.95367 WP_001831053.1.95589 WP_001831053.1.95903 WP_001831053.1.96333 WP_001831053.1.96627 WP_001831053.1.96673 WP_001831053.1.96799 WP_001831053.1.96825 WP_001831053.1.97286 WP_001831053.1.97364 WP_001831053.1.9749 WP_001831053.1.97896 WP_001831053.1.98025 WP_001831053.1.98274 WP_001831053.1.98568 WP_001831053.1.98813 WP_001831053.1.98959 WP_001831053.1.99474 WP_001831053.1.99601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]