SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu0239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu0239
Domain Number 1 Region: 55-160
Classification Level Classification E-value
Superfamily Regulatory protein AraC 5.1e-21
Family Regulatory protein AraC 0.0062
Further Details:      
 
Domain Number 2 Region: 247-292
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000242
Family AraC type transcriptional activator 0.03
Further Details:      
 
Weak hits

Sequence:  176299.Atu0239
Domain Number - Region: 197-244
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000103
Family Tetracyclin repressor-like, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu0239
Sequence length 298
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MTAILVSNMRTQSGCGYEREAILAPRGSNDLERSCKFEGIVQARSSEGIERIDARFHGNA
YAPHRHDTYALGVTLSGVQTFSYRGTSHFSMPGNVIVLHPDEIHDGGAGTDEGLHYRMLY
LPPEKTTEAGYNTLPFARSAVIEDEEFRQCLTEALGNLDGEPDSLLLTDWQSRLSDLLWK
HSNGSARSIKWIDRAAVLLCRDYLLENSADTVVSQELEQISGLDRFTLFRHFRCVFGTSP
HRYLIMRRLQKCKDMMRAGASLAETAFACGFADQAHFTRHFKNAFGMPPGRWLSLVSH
Download sequence
Identical sequences A0A0F4FXD9 Q7D1V9
NP_353270.2.86381 WP_010970753.1.51814 WP_010970753.1.57042 gi|159184226|ref|NP_353270.2| 176299.Atu0239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]