SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 176299.Atu1647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu1647
Domain Number 1 Region: 23-95
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000255
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 
Weak hits

Sequence:  176299.Atu1647
Domain Number - Region: 196-287
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.00759
Family DmpA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu1647
Sequence length 386
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MQEQDTRQQANPAAITEDDAVSGGGSRYVLSGSWRNSNLSGIFESLDRIEKSKPASPVDI
DLSAVEAIDTTGAWIIQRLRKDLEASGATVTLTGNDRIEDVIGQLPDKAEMDVEPVAREG
LVERIFAPIGQAVVQNGADFLAGMYILGSAVRGAQMKLGRGRGVSPAAIVNQIDHMGVRA
VPIIMLMSFLIGAIIAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSA
ITAEIGSMKMREEIDALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVAL
AYSGITFEVFLSRLHGAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVT
SSVVKSIFVVILVDGLFAIFYAAIDF
Download sequence
Identical sequences A0A083ZBK8 Q7CYT6
NP_354638.2.86381 WP_010971769.1.51814 WP_010971769.1.57042 176299.Atu1647 gi|159184854|ref|NP_354638.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]