SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 176299.Atu3773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  176299.Atu3773
Domain Number - Region: 97-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0102
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu3773
Sequence length 154
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MLQRLATELGPWSWWIVGFVLLAAELIAPGVFLIWIGLAALVIGVVSLFFWEAAFWAWQL
QLVLFAALSVVFALLGRRYFGRNHATSDEPFLNQREASLVGRTATLQEPIVEGRGRIRLD
DTWWPVNGEDLPAGTRVRIASARGRTLTIEPIDR
Download sequence
Identical sequences A0A083ZG51 A0A1G8WEI3 A0A1S7R003 A9CFM6 F5JD24
GO.2543 gi|15891177|ref|NP_356849.1| NP_356849.1.86381 WP_006313449.1.11033 WP_006313449.1.24142 WP_006313449.1.51814 WP_006313449.1.57042 WP_006313449.1.66048 WP_006313449.1.84136 WP_006313449.1.9015 176299.Atu3773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]