SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu4659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu4659
Domain Number 1 Region: 16-166
Classification Level Classification E-value
Superfamily Regulatory protein AraC 3.4e-20
Family Regulatory protein AraC 0.0029
Further Details:      
 
Domain Number 2 Region: 236-286
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000139
Family AraC type transcriptional activator 0.018
Further Details:      
 
Domain Number 3 Region: 184-234
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000106
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu4659
Sequence length 295
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MGNFVLRDLIDQGPGMRTVSLPRGRQTLHTMPTSSGYEIRRGGNYDWDGRKRGQTPFTVL
QYCIAGQGNLRYENRHYVVRPGETLLLLIPHNHRYWLEDGKEWEFFWISMNGEEALRIHR
NILSVTGPILKLQQETVDHLAECCSRLVNGAETPGAASAVAYEAAMTLYDDVFGSHPSFG
GEYRTLQQVLSYIDSHLGERLSVSDLAAVAGLSRAHFSRIFTASEGLPPAEFVLQRRLRR
AAKLLTTAANIPIKEVSVLCGFEDPNYFSKVFRRLYGINPSEFRTTGMYASIRQG
Download sequence
Identical sequences A0A083ZM59 A0A1G8Y6H0 A9CGY9
gi|15890331|ref|NP_356003.1| 176299.Atu4659 NP_356003.1.86381 WP_010974053.1.11033 WP_010974053.1.51814 WP_010974053.1.57042 383046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]