SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 176299.Atu5195 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu5195
Domain Number 1 Region: 87-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.05e-33
Family Phosphate binding protein-like 0.014
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.05e-18
Family LysR-like transcriptional regulators 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu5195
Sequence length 305
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MDINVALKAFIRTVEKGSITAAARDLGVTQPAVTKHISNLERHVQARLLERSSKIVRPTA
HGLELYEASRIAIASIDAALEGVRINTGEIEGNLRIHAPSCIGVGHLERIVGEFQDEYCG
ISVELALDERTVDLVYDNFDLSVHYGKIEDQDVIARRIGWVERFLVASPLYLEQVGQIND
TGRLSELEVIGTPKMLAQRNTISLLGPSARAEDVAVRPLLITNNAHVMIAALLRGRGVGL
VQKNLVLDLLASGELVRVLPEYWLRSTEAFLAYPSTKFMRPVVRAFTDFVMPRLRNIDGI
SPEQR
Download sequence
Identical sequences A0A083ZMI8 A9CLL0
gi|16119418|ref|NP_396124.1|NC_003064 176299.Atu5195 gi|16119418|ref|NP_396124.1| NP_396124.1.86381 WP_010974453.1.51814 WP_010974453.1.57042 WP_010974453.1.66048 WP_010974453.1.84136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]