SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 176299.Atu6022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  176299.Atu6022
Domain Number 1 Region: 1-75,261-336,365-404
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0000216
Family Actin/HSP70 0.039
Further Details:      
 
Weak hits

Sequence:  176299.Atu6022
Domain Number - Region: 134-188
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0127
Family D-glucarate dehydratase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 176299.Atu6022
Sequence length 678
Comment (Agrobacterium tumefaciens C58 Cereon)
Sequence
MLRIGVDIGGTFTDFCGWREGEDRIVTLKVPSTPPAFENGFREGFEKLLERLAPEPGEAA
FLMHGTTVSTNAVIERKGPKIAFFVTKGYRDLLELQRIGVRNPLNLFETRTRPLIDREMV
FEVEERLLRGGLVRTSIDEAAVEALARRAADAGAAGYAVALLHSYANPQHEQAVARAIRK
AVGEDAEVSLSSEIWPRIGEYERAIVSVLNAFVKRRMNEYIGAVETYVAERLPGSQLFVT
RSNGGAMAASEARNFPVHTLLSGPASGVTAVQYLGRALGEHNILTMDMGGTSTDISLVRD
GEALTSTSAEVGEFPVVMPVTSIEAIGAGGGSVVTIDGGVLRIGPRSAGSYPGPACFSRG
GTEPTLTDAFLLAGYLPEALLGGDMQLDRHAAERAMAPIAETLKTDVLSAAEMCVTVASS
NMVAGVLPYLARQGVDPEDLTVLVYGGAGAIQGPLLAAEIGVNRVLVPATPSVFCALGGL
VSDLSNDALETVHGLDIDGSLIAKKFQVLREQGAEWLSRQAPPERLVSKTFECWAEMRYV
GQSFQVDVRLPDTAIEAHDIAAMHAAFHQEHERIYSHADKAAPVEFVDLRMRVRGSMSIP
QPSTPETSGAGGALKTVRSMRFHNKLIPEVRVFDRASLTPNDAIQGPAVIEQRDATIVVP
PEFVARVGAFGAILMTRS
Download sequence
Identical sequences A9CL05
176299.Atu6022 gi|16119834|ref|NP_396539.1|NC_003065 gi|16119834|ref|NP_396539.1| NP_396539.1.86381 AtR153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]