SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 177416.FTT_1684 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177416.FTT_1684
Domain Number 1 Region: 96-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.77e-31
Family Phosphate binding protein-like 0.0065
Further Details:      
 
Domain Number 2 Region: 4-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.66e-20
Family LysR-like transcriptional regulators 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 177416.FTT_1684
Sequence length 300
Comment (Francisella tularensis tularensis)
Sequence
MTMNKHKNISISLFEAFYQLVVHGSFTNTAKALGISKAAVSHTIKQLEKELKVDLLNRTT
RSLSLTHEGMLLFNYCKTLQNEIDNIRDLAESFHKEPSGTLKISTSSFFAQNILINLIKE
YSKKFSKVKIEVSIEEKMPNFKSNEADIILGVNWTPPENIVARKIASTRYVLCASPAYIN
KNGSPSNISDLANHNYIPHKSRVTPLVNIKKNKLNPQTLPSNISANNIEFIKACVLNDFG
IAQFHEYIVKNEIQNSQLIELLKDNFFDQQDIYIYYPKNKFVQPKVKEFVNLVINSQISI
Download sequence
Identical sequences A0A1L6V9E3 Q5NEF3
177416.FTT_1684 393115.FTF1684 WP_011242292.1.101979 WP_011242292.1.10388 WP_011242292.1.11695 WP_011242292.1.1833 WP_011242292.1.19035 WP_011242292.1.2301 WP_011242292.1.25812 WP_011242292.1.31410 WP_011242292.1.35965 WP_011242292.1.36081 WP_011242292.1.3831 WP_011242292.1.38368 WP_011242292.1.38474 WP_011242292.1.38662 WP_011242292.1.40634 WP_011242292.1.44744 WP_011242292.1.52816 WP_011242292.1.56738 WP_011242292.1.5829 WP_011242292.1.59625 WP_011242292.1.60146 WP_011242292.1.61154 WP_011242292.1.65967 WP_011242292.1.66077 WP_011242292.1.66092 WP_011242292.1.67317 WP_011242292.1.75261 WP_011242292.1.77053 WP_011242292.1.80616 WP_011242292.1.82545 WP_011242292.1.87851 WP_011242292.1.98147 YP_170589.1.84429 gi|56708693|ref|YP_170589.1| gi|110671165|ref|YP_667722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]