SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177437.HRM2_12000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177437.HRM2_12000
Domain Number 1 Region: 112-352
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-50
Family D-glucarate dehydratase-like 0.0000588
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9e-26
Family Enolase N-terminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 177437.HRM2_12000
Sequence length 354
Comment (Desulfobacterium autotrophicum HRM2)
Sequence
MKIKEITIWKEDLALTRPYTIAYETISAVENVFVLLETDNGITGIGAGSPAEDVTGETIT
ATETALSLKLAPILQGKDIRSCFSLLKELNTALADTPAALAAADIALHDLAAKTMGLPLV
DLLGRVHDRLPTSITIGIMPVKETLAEAEEYLGRGFSILKIKTGLNVEEDIERIIRLNET
FKSKICMRVDANQGYEVEELHHFFKKTVGLVEFIEQPLKAEHLEKMGQLPQAIRRVSAAD
ETLLGPRDAAQMLHAPRPFGIFNIKLMKCGGIAPGLEIANMAGHADIDLMWGCMDESIVS
IAGALHAAFSSRATRYLDLDGSLDLARDIVNGGFILENGWMRTTDQPGLGVKRI
Download sequence
Identical sequences C0QM06
WP_015903101.1.52472 NYSGXRC-9454f NYSGXRC-9497a 177437.HRM2_12000 gi|224368313|ref|YP_002602476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]