SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177437.HRM2_17740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177437.HRM2_17740
Domain Number 1 Region: 24-182
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.81e-16
Family Clp protease, ClpP subunit 0.082
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000034
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 177437.HRM2_17740
Sequence length 499
Comment (Desulfobacterium autotrophicum HRM2)
Sequence
MNPSKKKSHAFLNILWIILLPIFIIVTFQTRVTGTDGEKTDKIKVYEIKVEGPVEPGMAA
FLERALAVDDSPAALFVLKMDTFGGRVDSALAIVDLIVNIPKGRTIAFVVNKAISAGALI
SLACNDLVMKDHTTIGDCAPIMNSSEGPKMMGEKFQSPLRAKFRSLAKRNNYPEALAEAM
VSDHIAVYEVTEAGQTRYIDSRAYEDLTDDERGAITARKTIISKGELLTMDAIEAERLGF
SRMTVGSVAEMLERMGVSNYEIVSIEESWSETFFRFLTKISPILMVIGLGALYTEIKSPG
FGLPGLVGIVCLGFVFAGQYIVGLAGYTEFLLIVAGMLFFAGEVFVLPGFGISGILGLIL
MGAGMVLALQDFVIPDPDLPWQGKLLKANLIQVLASFLAGLFIALGVIRYLLPRLSRVIA
GPYLDATLKDSHADSMEIRRASVGDRGVAATFLRPAGKVEINGEIFDAVSQGEFIEQGSL
IFVAMIQGNRLIVTAEEKK
Download sequence
Identical sequences C0QB79
gi|224368878|ref|YP_002603040.1| WP_015903664.1.52472 177437.HRM2_17740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]