SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177437.HRM2_49250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177437.HRM2_49250
Domain Number 1 Region: 12-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000194
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 177437.HRM2_49250
Sequence length 373
Comment (Desulfobacterium autotrophicum HRM2)
Sequence
MAALSINHDNAQGTTVTLSGSLDIAGVSKVWEKAEKALFGTGDLVIDLKRVDHMDSAGAA
LVWFIKTTWKQRTGGKISVLGLKPAFKQVMDLTETIPDTRDGEKKPKKKPPSFVETRGKN
FADQMEKATSFIALVGQITRALIHAFFHPLSVRWKDALLTAERSGVNALPIVALISFIVG
LVMAFQAAMPMKMFGAEIYVANLIGIAMVRELGPLMTAIILAGRSGSAFAAEIGTMKINE
EIDALSTMGLDPVRFLMVPRILAAVFITPLLTIFSNFVGIMGGSIVLLSMGYPAITYYSQ
VISFVTWIDFTGGLVKCFVFGILISAAGCIRGIETQSGPGAVGASTTSAVVTGITLIAVF
DGIFSVLFYCLGI
Download sequence
Identical sequences C0QIM9
gi|224371971|ref|YP_002606137.1| WP_015906680.1.52472 177437.HRM2_49250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]