SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177439.DP0041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  177439.DP0041
Domain Number - Region: 21-160
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000328
Family Cystathionine synthase-like 0.039
Further Details:      
 
Domain Number - Region: 143-226
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0392
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 177439.DP0041
Sequence length 324
Comment (Desulfotalea psychrophila LSv54)
Sequence
MMNSEAIGGYFELELPVAKQSLYPQALRYQSARSAFYALILYVNPRRIWMPLYICDAMLA
PVHKAGVEVSFYSLNDDFSIKEDLKLQENDLLLYVNYFGVCGKQQLKILEKYNSDQIVFD
HSQAFFQAPLDCLATIYSPRKFFGVPDGGFLVTNVSMVEPEEIDEDSIKRSIHLLKRLAD
SAEFGYLDYQLAEKTLMDFVPKKMSKLTERLLSVVDYDAVRTARNENFLYIHSILGGSNK
ININLSFVDGPMVYPFLYAQEGLKDILIKSRVFISTYWAECIDKVEDGCFEQKLVNMLVP
LPCDQRYALEEIRIILSVMNRIGI
Download sequence
Identical sequences Q6AS93
177439.DP0041 gi|51243893|ref|YP_063777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]