SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177439.DP1199 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP1199
Domain Number 1 Region: 10-263
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.009
Further Details:      
 
Domain Number 2 Region: 242-299
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000177
Family Short-chain ferredoxins 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 177439.DP1199
Sequence length 309
Comment (Desulfotalea psychrophila LSv54)
Sequence
MFLQREGVVMYRIRFHGRGGQGMKTASRILGTAFFLEGYEVQDAPRYGAERRGAPIFAYV
RADNQPINERGIISQPDLVIVADDSLVGLPAAAVLAGVDEHTLLLISSAESGEMWQDRLN
FAGEIFTMPAEAQFVGAACTGAAACLLGDISPVALEKAIREELADLGDAVIEENIVPALT
AYKRMQPYRGRVQTGIAINANDYSKPGWIDLPFEDARISAPDIHASANSVEVRTGLWRTL
RPVIDYQRCKGCWWICSTFCPDGAIPVRGKIPEIDYDHCKGCMICVAQCPTHAIEAVSER
LAQEQEVLS
Download sequence
Identical sequences Q6ANZ6
177439.DP1199 gi|51245051|ref|YP_064935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]