SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177439.DP1262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP1262
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.42e-48
Family Voltage-gated potassium channels 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 177439.DP1262
Sequence length 264
Comment (Desulfotalea psychrophila LSv54)
Sequence
MGRQSPLSLVSMEKFVEIRIQLRDILENSTTRMSKIIYWVIHCLIITALVSFTVHTLPEL
SPTAKQILYLVDLACLCLFSVEYLLRLFAAENRFRFVCSFFGIVDLLAILPYFLTLGLFD
MRVLRLLRLLQLFKVARYNKVFKRYYRACLLLRVDLAFFLAVALITVYLAAVGIYHFENL
AQPDKFGSIFQSLWWSVVTLTTVGYGDVFPITTGGKVFTFVLLIIGLGLVSVPAGLVASA
LGEAREIEKVEEKGKPEYGETHEQ
Download sequence
Identical sequences Q6ANT3
WP_011188503.1.98904 gi|51245114|ref|YP_064998.1| 177439.DP1262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]