SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177439.DP1870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP1870
Domain Number 1 Region: 84-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000124
Family NfeD domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 177439.DP1870
Sequence length 153
Comment (Desulfotalea psychrophila LSv54)
Sequence
MVKNMTLSYSLIWFLVGVLFLIVELLLPGFILIFFTAGCWIAGLTAWLTDIGLPTQILIF
IISSLLFLFSLRRYCLKTFKGSTRDDHEDPYINSKIGKTALVTKEISANTPGEIKVMGSF
WRAVADESIEEGQSVLVTSQESEDGLTFRVKKL
Download sequence
Identical sequences Q6AM26
177439.DP1870 WP_011189111.1.98904 gi|51245722|ref|YP_065606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]