SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 177439.DP3020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  177439.DP3020
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-18
Family Voltage-gated potassium channels 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 177439.DP3020
Sequence length 167
Comment (Desulfotalea psychrophila LSv54)
Sequence
MVWLMKRLKYSTKFFKDISLHTPFVKMLALLIILWLIFSAALYFSESNVEGSSIHTYGDA
LYWGIAAFSTAGIADSPTSNTAQFVGGLWIVIGSMLFFGTIVATITTYFMRPMQRPHRRI
IDAIEYNLEQLDDLTVEELSLLKNTVDALIMHVERMRKKQDDEQQAE
Download sequence
Identical sequences Q6AIT1
gi|51246872|ref|YP_066756.1| 177439.DP3020 WP_011190261.1.98904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]