SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 178306.PAE0749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE0749
Domain Number 1 Region: 16-177
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.25e-23
Family Clp protease, ClpP subunit 0.053
Further Details:      
 
Domain Number 2 Region: 363-425
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000641
Family NfeD domain-like 0.0049
Further Details:      
 
Weak hits

Sequence:  178306.PAE0749
Domain Number - Region: 152-234
Classification Level Classification E-value
Superfamily CalX-like 0.0288
Family CalX-beta domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE0749
Sequence length 428
Comment (Pyrobaculum aerophilum)
Sequence
MRIGVLLSLAVVFLHAYVVSSVYVVEINNVIGPYTLSQVQRAISLAEQNNGAVLLLLSTP
GGLADVTLQIMREIGNSPVPVIGYVYPDYSYAWSAGTYILMSTHIAAMAPHTVIGSCQPI
AGGTPINESKTLNALIGYLETVSKSYGRNGTFARLCITQNLNLGAEEALRQRVIDVIAID
INDLLKKINGTLVLLRNQKTQLIITSTILKRAEPTITETLQMWLSDPVVSSILSLLAFIL
LLAAFLTGHPAAVVAAIILLVISMFSFLPTAWLGLALIIMGAVLIMAEILMGMAAHGAVA
GVGAVLLIIGFLSAYPANFFSGELIHIKDWWLIQLGLYIDIAIFLGFLSFVIYKIIILYK
QRPPSEFLTSLKGVEGVAIDDIGPESPGFVKVFGEYWRAVSDTPVRKGCRIRVVETIGDM
LKVEPLQC
Download sequence
Identical sequences Q8ZYJ1
gi|18312153|ref|NP_558820.1| 178306.PAE0749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]