SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 178306.PAE1040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  178306.PAE1040
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE1040
Sequence length 175
Comment (Pyrobaculum aerophilum)
Sequence
MGLLEVRFHGRGGQGMVTAAQVLAAAAILEGKYAQAFPEFGPERRGAPVKSYLRISDRPI
YIREPILRPDVIVVADQSLFKAENPFEGAKENTILVVNGAYKAPIKTYYVDATSLAMKVL
GRPIVNTAIIGAVVKATGLVSLSSVAEALKKYFSGRLYDLNLKLVEMAYQETVGL
Download sequence
Identical sequences Q8ZXX7
gi|18312370|ref|NP_559037.1| 178306.PAE1040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]