SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 178306.PAE1387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  178306.PAE1387
Domain Number - Region: 16-59
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0247
Family HEPN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 178306.PAE1387
Sequence length 163
Comment (Pyrobaculum aerophilum)
Sequence
MLVVHPWRDLRKYVEIRLEEAEAELRLAERFLEEGLYRNAAGKAFQAWKSLMAAIGAMYR
DVLAKHFPGVVKTRDGKTVPRVDWVLAYMPTTRLREVAIRLRGVAEFDIVSLTDLALNLH
EFQYNGVDKEAVLSRYTALDLAVSDLNYFIEKCKEVLRKAKTK
Download sequence
Identical sequences Q8ZX97
gi|18312603|ref|NP_559270.1| 178306.PAE1387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]