SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 182082.CpB1052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  182082.CpB1052
Domain Number 1 Region: 443-547
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 182082.CpB1052
Sequence length 565
Comment (Chlamydophila pneumoniae TW 183)
Sequence
MKVPWAFKNFIPKLYTSIKEGYSFNTFKKDFQAGITVGILAFPFAIAIAIGVGVSPIQGL
LASIIGGLLASAMGGSNVLISGPSSAFISILYCLSAKYGAEALFTVTLLAGVFLIAFGLT
GLGTFIKYMPYPVVTGLTTGLAIIIFSSQIKDFLGLQMGANIPADFLPKWIAYWDHLWTW
DSKSFAVGLFTLLIMIYFRNYKPRYPGVMIAIVTATTLVWLLKIDIPTIGSRYGTLPTAI
PLPKIPQLSITKILQLMPDALTIAVLSGLETLLSAVVADGMTGWRHQSNCQLVAQGVANI
GTSLFSGIPVTGSLSRTAASIKSEATTPIAGIVHSIFICFILLLLAPLTVKIPLTCLAAV
LILIAWNMSEIHHFIHLFTAPKKDIVVLLTVFILTVMTTITAAVQVGMMLAAFLFMKQMS
DLSDVISTAKYFDKDSDFLSKAEVPQNTEIYEINGPFFFGIADRLKNLLNDIEKPPKIFI
LCMTRVPTIDASAMHALEEFFLECDRQGTLLLLAGVKKTPLADLKRYHLDELIGVDHIFS
NIKSALLFAQALTNLESKTSTRHLV
Download sequence
Identical sequences Q9Z6P5
gi|15618922|ref|NP_225208.1| gi|33242383|ref|NP_877324.1| 115711.CP0839 115713.CPn1014 182082.CpB1052 NP_225208.1.662 WP_010883647.1.15326 WP_010883647.1.24544 WP_010883647.1.35099 WP_010883647.1.48548 WP_010883647.1.81029 WP_010883647.1.8178 WP_010883647.1.91433 WP_010883647.1.95540 gi|16752012|ref|NP_445378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]