SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 183190.PD0121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  183190.PD0121
Domain Number - Region: 129-176
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00424
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 183190.PD0121
Sequence length 190
Comment (Xylella fastidiosa Temecula1)
Sequence
MYCWHQNGQRVCSDTLPAEAVNDAREEFNAKNGMLKGEVQRALNENERAATASEEAQRRA
GQDAQETRKRADQIMLASFQTEDDLRQVFLKRIATIDNNLKIARYNATNLRQGLVNLLRN
ANERELAGQKVPEKLAADIEQRRQDLLSQQRLHTSFEQERATLSGEIEETLQRYRALKSS
EANASPLAEP
Download sequence
Identical sequences Q87F17
gi|28198057|ref|NP_778371.1| 183190.PD0121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]