SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 183190.PD0150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  183190.PD0150
Domain Number - Region: 102-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00811
Family NfeD domain-like 0.0084
Further Details:      
 
Domain Number - Region: 22-75
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.034
Family ABC transporter transmembrane region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 183190.PD0150
Sequence length 144
Comment (Xylella fastidiosa Temecula1)
Sequence
MMRWDAMGWAAAALLLLAAETLIPGAFMLWMGIAAAAVFVGVLLLPDISLLLQMFAFVVL
SFVSIYLYRTWFRHIDHDSDHPLLNRRADQLVGRIIILDHAIVDGNARIKIDDTFWDITG
PDLPIGTQIRIVALDGTTLKVHPT
Download sequence
Identical sequences Q87EZ5
GO.2660 gi|28198081|ref|NP_778395.1| 183190.PD0150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]