SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 183190.PD1152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  183190.PD1152
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.99e-78
Family Phosphate binding protein-like 0.000000744
Further Details:      
 
Domain Number 2 Region: 218-303
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.14e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 183190.PD1152
Sequence length 305
Comment (Xylella fastidiosa Temecula1)
Sequence
MPLLRIATRKSLLAMWQSEYVAARLRMLCPDLDVVLVPMSTRGDEILDRSLAAIGGKGLF
LKELELAMLRGDADCAVHSLKDVPMDLEPPFMLAAVLSRDDPADALISNVYLSLESLPIG
ARVATSSLRRQAQLRFYRPDLRLFDLRGNVNTRLAKLDNGDYDAIVLACAGLRRLGLEQR
MTARLAPPEWLPAPGQGAIAVESLTEDARIGTLLAGLDDLPTRKCVIAERTMNRALHGSC
HVPVGAYASYEVGGMRLQGLVGCVADGRLVRAELCSAKDEGDMLGRAVAQCLLDAGAAEL
LAATA
Download sequence
Identical sequences A0A0E3C2P8 B2I5K8 Q87CC9
gi|28199044|ref|NP_779358.1| WP_004087310.1.14680 WP_004087310.1.15411 WP_004087310.1.44032 WP_004087310.1.44309 WP_004087310.1.56643 WP_004087310.1.69964 WP_004087310.1.86577 WP_004087310.1.88863 WP_004087310.1.90029 gi|182681767|ref|YP_001829927.1| gi|386085249|ref|YP_006001531.1| 183190.PD1152 405441.XfasM23_1225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]