SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 186103.spyM18_0798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186103.spyM18_0798
Domain Number 1 Region: 139-433
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.25e-126
Family Enolase 0.000000000209
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.33e-58
Family Enolase N-terminal domain-like 0.000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 186103.spyM18_0798
Sequence length 435
Comment (Streptococcus pyogenes MGAS8232)
Sequence
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYL
GLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVAR
AAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMIMPVGAPTFKEGLR
WGAEVFHALKKILKERGLVTAVGDEGGFAPKFEGTEDGVETILKAIEAAGYEAGENGIMI
GFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQVDYLEELVNKYPIITIEDGMDENDW
DGWKVLTERLGKRVQLVGDDFFVTNTEYLARGIKENAANSILIKVNQIGTLTETFEAIEM
AKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGE
VAQYKGIKSFYNLKK
Download sequence
Identical sequences A0A0E1ETG9 A2RFE3 A3F8V6 B5XKM7 F5U4S4 J7M7A0 K4Q837 P0DA94 P0DA95 P69949 P69951 Q1J7I5 Q1JHQ6 Q48UF7 U2UA69
NP_268959.1.14755 WP_002985288.1.100177 WP_002985288.1.100791 WP_002985288.1.100847 WP_002985288.1.100902 WP_002985288.1.101138 WP_002985288.1.101603 WP_002985288.1.101866 WP_002985288.1.10776 WP_002985288.1.11114 WP_002985288.1.11468 WP_002985288.1.11642 WP_002985288.1.11796 WP_002985288.1.12676 WP_002985288.1.13094 WP_002985288.1.134 WP_002985288.1.13655 WP_002985288.1.13723 WP_002985288.1.13803 WP_002985288.1.14556 WP_002985288.1.1526 WP_002985288.1.15867 WP_002985288.1.16107 WP_002985288.1.16883 WP_002985288.1.17594 WP_002985288.1.17618 WP_002985288.1.19034 WP_002985288.1.19471 WP_002985288.1.19971 WP_002985288.1.20146 WP_002985288.1.20187 WP_002985288.1.20282 WP_002985288.1.2074 WP_002985288.1.20768 WP_002985288.1.21068 WP_002985288.1.22587 WP_002985288.1.22927 WP_002985288.1.22931 WP_002985288.1.23344 WP_002985288.1.23345 WP_002985288.1.23366 WP_002985288.1.23784 WP_002985288.1.23854 WP_002985288.1.24256 WP_002985288.1.24700 WP_002985288.1.24771 WP_002985288.1.24800 WP_002985288.1.25570 WP_002985288.1.26201 WP_002985288.1.26216 WP_002985288.1.26529 WP_002985288.1.26775 WP_002985288.1.26802 WP_002985288.1.26942 WP_002985288.1.27096 WP_002985288.1.27102 WP_002985288.1.2743 WP_002985288.1.27781 WP_002985288.1.28087 WP_002985288.1.28592 WP_002985288.1.29494 WP_002985288.1.29629 WP_002985288.1.30208 WP_002985288.1.30461 WP_002985288.1.31038 WP_002985288.1.31126 WP_002985288.1.32791 WP_002985288.1.33081 WP_002985288.1.34145 WP_002985288.1.34147 WP_002985288.1.34154 WP_002985288.1.34661 WP_002985288.1.35136 WP_002985288.1.35339 WP_002985288.1.35535 WP_002985288.1.35765 WP_002985288.1.3577 WP_002985288.1.35796 WP_002985288.1.35803 WP_002985288.1.36083 WP_002985288.1.36559 WP_002985288.1.3764 WP_002985288.1.38004 WP_002985288.1.39245 WP_002985288.1.39740 WP_002985288.1.39774 WP_002985288.1.40473 WP_002985288.1.4053 WP_002985288.1.40861 WP_002985288.1.41087 WP_002985288.1.41146 WP_002985288.1.41398 WP_002985288.1.41814 WP_002985288.1.42026 WP_002985288.1.42545 WP_002985288.1.43805 WP_002985288.1.44171 WP_002985288.1.44357 WP_002985288.1.45044 WP_002985288.1.45784 WP_002985288.1.45787 WP_002985288.1.47538 WP_002985288.1.47933 WP_002985288.1.48446 WP_002985288.1.49019 WP_002985288.1.49195 WP_002985288.1.49308 WP_002985288.1.51065 WP_002985288.1.51111 WP_002985288.1.51270 WP_002985288.1.51625 WP_002985288.1.51729 WP_002985288.1.52414 WP_002985288.1.52458 WP_002985288.1.5275 WP_002985288.1.52963 WP_002985288.1.53322 WP_002985288.1.53400 WP_002985288.1.53936 WP_002985288.1.54994 WP_002985288.1.55040 WP_002985288.1.55521 WP_002985288.1.55942 WP_002985288.1.56335 WP_002985288.1.56455 WP_002985288.1.56879 WP_002985288.1.57070 WP_002985288.1.57973 WP_002985288.1.58073 WP_002985288.1.58327 WP_002985288.1.58465 WP_002985288.1.58955 WP_002985288.1.59543 WP_002985288.1.59971 WP_002985288.1.60269 WP_002985288.1.60378 WP_002985288.1.60429 WP_002985288.1.60446 WP_002985288.1.61350 WP_002985288.1.62427 WP_002985288.1.62548 WP_002985288.1.62966 WP_002985288.1.63074 WP_002985288.1.6385 WP_002985288.1.64024 WP_002985288.1.64314 WP_002985288.1.64903 WP_002985288.1.65209 WP_002985288.1.65729 WP_002985288.1.65801 WP_002985288.1.6624 WP_002985288.1.66344 WP_002985288.1.66918 WP_002985288.1.67715 WP_002985288.1.67764 WP_002985288.1.68191 WP_002985288.1.68302 WP_002985288.1.68539 WP_002985288.1.69171 WP_002985288.1.69206 WP_002985288.1.69961 WP_002985288.1.71085 WP_002985288.1.71714 WP_002985288.1.72435 WP_002985288.1.72664 WP_002985288.1.73416 WP_002985288.1.7367 WP_002985288.1.74272 WP_002985288.1.74376 WP_002985288.1.74388 WP_002985288.1.74440 WP_002985288.1.74742 WP_002985288.1.74766 WP_002985288.1.74769 WP_002985288.1.74773 WP_002985288.1.75067 WP_002985288.1.75380 WP_002985288.1.75397 WP_002985288.1.77086 WP_002985288.1.77451 WP_002985288.1.77602 WP_002985288.1.7902 WP_002985288.1.80549 WP_002985288.1.81017 WP_002985288.1.81227 WP_002985288.1.81317 WP_002985288.1.81523 WP_002985288.1.82325 WP_002985288.1.82884 WP_002985288.1.83533 WP_002985288.1.83959 WP_002985288.1.8445 WP_002985288.1.84495 WP_002985288.1.85790 WP_002985288.1.86460 WP_002985288.1.86569 WP_002985288.1.87245 WP_002985288.1.87367 WP_002985288.1.87596 WP_002985288.1.87861 WP_002985288.1.8796 WP_002985288.1.88361 WP_002985288.1.88809 WP_002985288.1.88958 WP_002985288.1.89166 WP_002985288.1.89339 WP_002985288.1.89421 WP_002985288.1.89609 WP_002985288.1.89617 WP_002985288.1.91460 WP_002985288.1.9206 WP_002985288.1.92241 WP_002985288.1.92390 WP_002985288.1.92885 WP_002985288.1.93188 WP_002985288.1.93335 WP_002985288.1.93434 WP_002985288.1.94718 WP_002985288.1.94743 WP_002985288.1.94988 WP_002985288.1.95191 WP_002985288.1.95380 WP_002985288.1.95441 WP_002985288.1.95717 WP_002985288.1.96175 WP_002985288.1.96236 WP_002985288.1.96338 WP_002985288.1.96528 WP_002985288.1.96685 WP_002985288.1.96787 WP_002985288.1.97489 WP_002985288.1.97674 WP_002985288.1.97748 WP_002985288.1.9843 WP_002985288.1.98938 WP_002985288.1.99902 WP_002985288.1.99981 gi|410680236|ref|YP_006932638.1| gi|470200712|ref|YP_007587141.1| gi|139474071|ref|YP_001128787.1| 160490.SPy_0731 160491.SpyM51248 186103.spyM18_0798 193567.SPs1375 198466.SpyM3_0479 319701.M28_Spy0535 370552.MGAS10270_Spy0615 370554.MGAS10750_Spy0639 471876.Spy49_0563 gi|19745827|ref|NP_606963.1| gi|28896287|ref|NP_802637.1| gi|386362415|ref|YP_006071746.1| gi|525809410|ref|YP_008242879.1| gi|94990124|ref|YP_598224.1| gi|94994035|ref|YP_602133.1| gi|410494454|ref|YP_006904300.1| gi|71903201|ref|YP_280004.1| gi|209559112|ref|YP_002285584.1| gi|15674785|ref|NP_268959.1| gi|21910015|ref|NP_664283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]