SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 186497.PF0754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186497.PF0754
Domain Number 1 Region: 201-449
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.15e-68
Family PFOR Pyr module 0.021
Further Details:      
 
Domain Number 2 Region: 8-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0046
Further Details:      
 
Domain Number 3 Region: 463-567
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000811
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 186497.PF0754
Sequence length 570
Comment (Pyrococcus furiosus)
Sequence
MKVVRDDISIVLGGAAGQGIQTVEVLLTHALKRAGYHVFGTKEYMSRIRGGINTTEIRVA
SRRVRAFVKRIDLLVPFKKGTLTWVKDRISDNTIVLGEKENIEEEFLEKINLVEVPLTKT
ALKVGSQLYLNTIAAGLIFGLFGAPVEIIESEVRNHFKGKSEKIVEKNVEAVREGYNIGR
SIAEEGKIVVDIKPDEKVKEEILLSGTEAVGIGALAGGMNFLSFYPMSPSTGVSTFAAQH
AEEFEIIVEQTEDEIAAINMAIGAWFAGARAMVSTSGGGFALMCEALSLAGMAENPVVIH
LAQRPGPATGLPTRTMQGDLNLVLYAGHGDFPRIILAPGTLEEAFYLTAEAFNLADKYQV
PVIILTDQYFVDSYYNLPEPDVSKVKVEKYIVKAEKGYKRYKLTEDGISPRAIPGYGEDV
VVANGNEHDEWGDITEDAEITRKMQEKRAIKKLETIKRNAPLPKIIGREDAKFYVISWGS
TFHIVEEALELLKRDDVAHVHFSWLYPLNPKIKDILAGKTLIAVENNVTGQFADLLKKEL
DIRVDHKILKYDGRPFAVEEVYEALKGVIE
Download sequence
Identical sequences I6V0J7 Q8U2S6
WP_011011883.1.13913 WP_011011883.1.59273 gi|397651254|ref|YP_006491835.1| Pfu-748906-001 186497.PF0754 gi|18977126|ref|NP_578483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]