SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 186497.PF1773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186497.PF1773
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 186497.PF1773
Sequence length 180
Comment (Pyrococcus furiosus)
Sequence
MRKEILLGGFGGQGIILASVILGRAAAVYEGLYAVQTQAYGPESRGGASRAEVVISDEPI
DYPKTVSPDYAILLSQQAYNKYLPLVKKGGIVILEEDLIPHRDPELEKDKEVHALPLTKI
AEETTGLSLTMNILTLGYFVGITKIVKKESIEKAVLDSVPKGTEKINLKALHKGFELSEK
Download sequence
Identical sequences I6V3U4 Q8U044
gi|18978145|ref|NP_579502.1| WP_011012914.1.13913 WP_011012914.1.59273 186497.PF1773 Pfu-1649361-001 gi|397652579|ref|YP_006493160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]