SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 187272.Mlg_0697 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187272.Mlg_0697
Domain Number 1 Region: 198-452
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.041
Further Details:      
 
Domain Number 2 Region: 8-220
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0088
Further Details:      
 
Domain Number 3 Region: 467-572
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.85e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 187272.Mlg_0697
Sequence length 576
Comment (Alkalilimnicola ehrlichei MLHE-1)
Sequence
MKTHSLSLALTGSGGTGVMTAGQILLDAAAQAGWYGLMTRSFGPQIRGGEAAAILRLAHQ
PVGCQDDQLDLLLAFDWGNIERFIAELPLGGDSVVIADPSQGDVPEVVVRTGASQSMIPI
KEVTKGVKGGRANMVGLGLVAELIGLPEEALLRTLQKVLGRKGEEALATAQACLSAGRAQ
ADTVGVDLRLASNGTAQGERWALSGNEAAGMGAVRGGVRFSAAYPITPSTDVVEWLAPTL
PRVGGCLVQAEDELSAINMCIGASFGGTPALTATSGPGLSLMVESLGLAVASETPVVVVN
VMRGGPSTGIPTKSEQADLNIALYGLHGDAPHLVVAANGIADCLAATQWAVHLAEALQSP
AIVLSDQALGQARAVIDRPQRVDYRAQRKTADRPGEGYLRYAITEDGVSPMAIPGTPCGE
YTADGLEHAERGTPSTQASHHQAQLDKRLRKLTGHDYGAYWADIEGDGELAVITWGSSTS
PVREALERAQAEGITARMVSVRLLSPAQPEALAAALDGVSRLLVVEQSHDGQFHRYLRAH
YDLPGTVRAFHHPGPLPIRPGEVLEQLRQLAQQEAA
Download sequence
Identical sequences Q0AAT6
gi|114319858|ref|YP_741541.1| 187272.Mlg_0697 WP_011628446.1.71132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]