SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 187420.MTH163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH163
Domain Number 1 Region: 10-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000041
Family MarR-like transcriptional regulators 0.086
Further Details:      
 
Weak hits

Sequence:  187420.MTH163
Domain Number - Region: 98-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0536
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH163
Sequence length 265
Comment (Methanobacterium thermoautotrophicum)
Sequence
MKALRKKGELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSG
RSHYKITRRGAEKIKEAAMDLRRYADEVLESMSFYRSVWPAIAWEDLQEGDKVELFMEDG
ILYARRRRNGEAYAEVLHPARRGEDVALSELGGTIPLQRGKVTIAVLPGISEGGSRNADL
ERLRELSRGHDRTGIMGTVSRAAANKLNLQVDFEFATPHAALAAAKRGLNVLVLAVGKMS
RSITEKLEKEGVEYSVEDLRLTHKE
Download sequence
Identical sequences O26265
WP_010875802.1.22989 gi|15678191|ref|NP_275306.1| 187420.MTH163 TT48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]