SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 187420.MTH693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  187420.MTH693
Domain Number 1 Region: 80-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000000105
Family NfeD domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 187420.MTH693
Sequence length 146
Comment (Methanobacterium thermoautotrophicum)
Sequence
MVGLMGPESWIIIAAICLIGEMLTTGFFLLWFAFGALAAAALGYLGFDTTAQFITFAAVS
VVLLGVSRPFAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTV
LDVGEEVSVKAIEGVKLVVEKLEEQK
Download sequence
Identical sequences O26789
gi|15678720|ref|NP_275836.1| WP_010876332.1.101079 WP_010876332.1.22989 187420.MTH693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]