SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 188937.MA0915 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA0915
Domain Number 1 Region: 23-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.44e-26
Family Clp protease, ClpP subunit 0.069
Further Details:      
 
Domain Number 2 Region: 369-432
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000955
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 188937.MA0915
Sequence length 434
Comment (Methanosarcina acetivorans)
Sequence
MQMKWVSHSLFIFCLCVTLTAFLAPSAGAAAEDKVLVLEISGAITPASDNLIADAIQSAE
SGNYEALVITLDTPGGGLEETQIIIKAIENTTMPVIGYVPESGKAWSAGTLILMGTDIAA
MAPFTVIGSAQPVQVSAEGTVPVEDEKTINALVKFSTETARKHGRNETFAEEVITENRNL
NAEEALEEGVIEYIAISVPNLLNQVDGEIVKGKELHTANATTETYKPPLPLSFLTLISNP
ILSSLLLTIGIYGIIFGISNPGAGAELFGVIAIVLGLIGTGFDINIAALFLIIVGIGLLI
LELNSPGFGIFGLAGIICLVIGSIFLVPLGSENIYTPEFRRLMILTIVTPTIVFGIFLVF
AIYKVAETRKKKPVIGAIIGDTARTIDPIGPKNPGFVRYKGEYWQAKAEEEIGAEEEVEI
TGKEMEVLVVKRKI
Download sequence
Identical sequences Q8TS89
188937.MA0915 gi|20089793|ref|NP_615868.1| WP_011020953.1.98848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]