SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 188937.MA2909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  188937.MA2909
Domain Number 1 Region: 34-266
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.95e-54
Family PFOR PP module 0.06
Further Details:      
 
Domain Number 2 Region: 304-480
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 188937.MA2909
Sequence length 482
Comment (Methanosarcina acetivorans)
Sequence
MKMAAEIIDGEKVIKKPKALYSEYPRKGGAAPTATHYCPGCGHGVLHKLIAEAIDDLGIQ
DRTVMISPVGCAVFAYYYFDTGNIQVAHGRAPAVGTGVSRAEENAVVISYQGDGDLASIG
LNETLQAANRGEKLAVFFVNNTVYGMTGGQMAPTTLIGEKTTTTPEGRDPRFAGYPLHMC
ELLDNLKAPIFIERVSVSDISHIRKARKAVRKALEVQRDGKGYAFVEVLAACPTNLRMDA
EQAIQFINEQMEKEFPLRNFRDNFESAEPLHRGISDFTTESLEKLYGIEAETGEKPSRTD
FAPIQTKIAGFGGQGVLSMGLILAQAGVKANLNASWFPSYGPEQRGGTSNCSVVISGQAI
GSPTVYTPDILIAMNRPSLERFEGAVKEGGFILYDSTIGEAETPAGVNAIAVPATEKAKE
AGDERAANSFMLGVLLGLNATGLEEEAFKEALAENFTGKPKVIEFNQQMLEAGAAWAREY
KV
Download sequence
Identical sequences Q8TLW4
gi|20091730|ref|NP_617805.1| 188937.MA2909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]